Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 3.5e-07
Breast cancer 1.200 4.5e-11
group 4 medulloblastoma -1.300 6.7e-04
ovarian cancer 2.600 4.2e-07
psoriasis 1.300 2.1e-04
tuberculosis 1.500 4.4e-09

AA Sequence

MEQDDPVEALTELRERRLGALELLQAAAGSGLAAYAVWALLLQPGFRRVPLRLQVPYVGASARQVEHVLS      1 - 70
LLRGRPGKTVDLGSGDGRIVLAAHRCGLRPAVGYELNPWLVALARLHAWRAGCAGSVCYRRKDLWKVSLR     71 - 140
DCRNVSVFLAPSVLPLLEDKLRTELPAGARVVSGRFPLPTWQPVTAVGEGLDRVWAYDVPEGGQAGEAAS    141 - 210
SRIPIQAAPGPSSAPIPGGLISQAS                                                 211 - 235
//

Text Mined References (6)

PMID Year Title