Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary


No data available



Accession Q96KT0
Symbols C8orf12

 Compartment GO Term (1)

 GWAS Trait (1)

AA Sequence

DSMLQKYKVKNAYRLHWQGREEPGASTFASLVFQ                                         71 - 104

Text Mined References (4)

PMID Year Title
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
16421571 2006 DNA sequence and analysis of human chromosome 8.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11896452 2002 Physical and transcriptional map of the critical region for keratolytic winter erythema (KWE) on chromosome 8p22-p23 between D8S550 and D8S1759.