Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.7e-80
ependymoma 4679 1.2e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 510 7.8e-03
Disease Target Count Z-score Confidence
Lipomatosis 12 4.003 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
autosomal dominant Emery-Dreifuss muscul... -1.095 7.8e-03
ependymoma 1.400 1.2e-03
psoriasis -2.000 5.7e-80

AA Sequence

MAVASTFIPGLNPQNPHYIPGYTGHCPLLRFSVGQTYGQVTGQLLRGPPGLAWPPVHRTLLPPIRPPRSP      1 - 70
EVPRESLPVRRGQERLSSSMIPGYTGFVPRAQFIFAKNCSQVWAEALSDFTHLHEKQGSEELPKEAKGRK     71 - 140
DTEKDQVPEPEGQLEEPTLEVVEQASPYSMDDRDPRKFFMSGFTGYVPCARFLFGSSFPVLTNQALQEFG    141 - 210
QKHSPGSAQDPKHLPPLPRTYPQNLGLLPNYGGYVPGYKFQFGHTFGHLTHDALGLSTFQKQLLA         211 - 275
//

Text Mined References (4)

PMID Year Title