Protein FAM163B

Property Summary

NCBI Gene PubMed Count	3
PubMed Score	0.00

Knowledge Summary

Patent

No data available

Expression

Specificity
Differential

Brain - Frontal Cortex (BA9) 18,069

Brain - Cortex 18,039

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Amygdala 18,006

Brain - Cerebellar Hemisphere 18,015

Brain - Cerebellum 17,983

Brain - Hypothalamus 18,169

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Hippocampus 18,011

Brain - Substantia nigra 17,981

Brain - Caudate (basal ganglia) 18,001

Testis 18,518

Brain - Putamen (basal ganglia) 17,863

Liver 18,071

Heart - Atrial Appendage 17,896

Nerve - Tibial 18,007

Adrenal Gland 18,071

Brain - Spinal cord (cervical c-1) 17,973

Colon - Sigmoid 18,089

Ovary 17,971

Pituitary 18,147

Breast - Mammary Tissue 18,103

Esophagus - Muscularis 18,017

Artery - Coronary 17,949

Spleen 17,614

Pancreas 18,123

Prostate 18,213

Lung 18,057

Thyroid 18,024

Colon - Transverse 17,825

Stomach 17,879

Vagina 17,834

Skin - Not Sun Exposed (Suprapubic) 18,081

Esophagus - Gastroesophageal Junction 18,000

Small Intestine - Terminal Ileum 17,954

Cells - Transformed fibroblasts 17,577

Adipose - Visceral (Omentum) 17,937

Esophagus - Mucosa 18,076

Minor Salivary Gland 18,005

Uterus 17,618

Skin - Sun Exposed (Lower leg) 17,968

Adipose - Subcutaneous 18,110

Artery - Tibial 17,631

Heart - Left Ventricle 18,006

Cells - EBV-transformed lymphocytes 18,186

Muscle - Skeletal 17,778

Kidney - Cortex 17,329

adipose tissue 15,837

adrenal gland 15,963

cerebral cortex 16,630

colon 15,959

duodenum 15,975

epididymis 15,863

esophagus 15,898

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lymph node 15,833

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skin 16,206

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

See source...

See source...

Synonym

Accession	P0C2L3 B2RUZ5
Symbols	C9orf166

Gene

FAM163B

Ortholog (3)

Species	Source	Disease
Xenopus 10,468	Inparanoid OMA
Mouse 16,570	Inparanoid OMA
Rat 15,117	Inparanoid OMA

UniProt Keyword (6)

Complete proteome 20,231

Reference proteome 20,231

Phosphoprotein 8,216

Membrane 7,361

Transmembrane 5,228

Transmembrane helix 5,207

GO Component (1)

integral component of membrane 3,665

Compartment GO Term (8)

Cytosol 6,686

Integral component of membrane 5,331

Intrinsic component of membrane 5,458

Membrane 8,531

Membrane part 6,554

Nuclear bodies 450

Plasma membrane 5,830

cellular_component 18,320

GWAS Trait (1)

Smoking behavior 34

HCA RNA Cell Line (17)

BEWO 16,726

CACO-2 15,436

EFO-21 17,301

HaCaT 16,515

Hep G2 15,179

HMC-1 16,581

Karpas-707 16,275

NB-4 16,547

NTERA-2 17,039

RPMI-8226 16,015

See all...

AA Sequence

MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKDESEEDEEEPDFAVHSHLPPLHSNRNLVLTNGP      1 - 70
ALYPTASTSFSQKSPQARALCRSCSHCEPPTFFLQEPPEEEEDVLNGGERVLYKSVSQEDVELPPGGFGG     71 - 140
LQALNPNRLSAMREAFARSRSISTDV                                                141 - 166
//

Text Mined References (4)

Summary
Details

	PMID	Year	Title