Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.97
PubTator Score 3.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.700 2.8e-03
Astrocytoma, Pilocytic -1.700 1.4e-05
atypical teratoid / rhabdoid tumor -1.600 4.2e-08
ependymoma -1.100 1.3e-03
glioblastoma -1.400 3.4e-04
group 4 medulloblastoma -1.100 3.5e-02
lung carcinoma 1.500 4.4e-07
medulloblastoma, large-cell -1.400 4.0e-03
osteosarcoma 1.010 1.6e-04
pituitary cancer -2.600 7.6e-05
primitive neuroectodermal tumor -1.200 4.0e-03
psoriasis -1.900 2.7e-04

Gene RIF (2)

AA Sequence

MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKSGTEVADEEEEREHDLPTHPRGPTCNACSSQAL      1 - 70
DGRGSLAPLTSEPCSQPCGVAASHCTTCSPYSSPFYIRTADMVPNGGGGERLSFAPTYYKEGGPPSLKLA     71 - 140
APQSYPVTWPGSGREAFTNPRAISTDV                                               141 - 167
//

Text Mined References (8)

PMID Year Title