Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.03
PubTator Score 5.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.179 1.4e-02
Multiple myeloma 1.892 1.1e-03
malignant mesothelioma 1.100 6.0e-04
astrocytic glioma -2.000 1.8e-02
esophageal adenocarcinoma -1.300 2.1e-02
glioblastoma -2.300 1.5e-03
osteosarcoma -1.079 3.9e-02
medulloblastoma -2.400 1.8e-05
atypical teratoid / rhabdoid tumor -2.300 4.2e-08
medulloblastoma, large-cell -2.800 2.0e-05
primitive neuroectodermal tumor -2.100 2.5e-05
primary pancreatic ductal adenocarcinoma -1.468 7.9e-04
non-small cell lung cancer 1.220 2.9e-14
lung cancer 1.400 9.4e-05
ulcerative colitis -1.900 2.4e-08
interstitial cystitis -2.400 1.2e-05
cystic fibrosis -1.300 7.1e-05
pediatric high grade glioma -1.800 4.5e-04
subependymal giant cell astrocytoma 1.334 3.7e-02
psoriasis 1.100 3.0e-13
Pick disease -1.500 6.1e-04
gastric carcinoma -1.200 3.8e-02
ovarian cancer 2.200 4.4e-05
pituitary cancer 1.100 6.8e-04
pancreatic cancer -1.500 8.8e-04

Gene RIF (6)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20840676 Expression and clinicopathological significance of human growth and transformation-dependent protein (HGTD-P) in uterine cervical cancer
19520982 HGTD-P plays a proapoptotic role in the developing rat brain following hypoxia-ischemia by activating caspase 3 and inducing the translocation of apoptosis-inducing factor (AIF) to the nucleus.
19269009 human growth and transformation-dependent protein expression is a common occurrence during the progression from a normal gastric mucosa to an intestinal-type carcinoma and may be associated with tumor cell proliferation activity
16698020 Heat shock protein 90 physically interacts with HGTD-P.
15082785 Data indicate that HGTD-P is a new hypoxia-inducible factor 1 alpha-responsive proapoptotic molecule that activates mitochondrial apoptotic cascades.

AA Sequence

MGSLSGLRLAAGSCFRLCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKI      1 - 70
LIWSGRFKKEDEIPETVSLEMLDAAKNKMRVKISYLMIALTVVGCIFMVIEGKKAAQRHETLTSLNLEKK     71 - 140
ARLKEEAAMKAKTE                                                            141 - 154
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20840676 2010 Expression and clinicopathological significance of human growth and transformation-dependent protein (HGTD-P) in uterine cervical cancer.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
19520982 2009 Proapoptotic role of human growth and transformation-dependent protein in the developing rat brain after hypoxia-ischemia.
19269009 2009 Expression and prognostic significance of human growth and transformation-dependent protein in gastric carcinoma and gastric adenoma.
16698020 2006 Interaction of pro-apoptotic protein HGTD-P with heat shock protein 90 is required for induction of mitochondrial apoptotic cascades.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15082785 2004 Identification of the hypoxia-inducible factor 1 alpha-responsive HGTD-P gene as a mediator in the mitochondrial apoptotic pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11085516 2000 Effects of estrogen on global gene expression: identification of novel targets of estrogen action.