Property Summary

NCBI Gene PubMed Count 25
PubMed Score 14.17
PubTator Score 18.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma 1.250 5.5e-03
astrocytic glioma -1.400 1.9e-02
chronic rhinosinusitis -1.209 3.3e-02
gastric carcinoma -1.800 1.2e-02
intraductal papillary-mucinous carcinoma... -1.500 1.1e-03
intraductal papillary-mucinous neoplasm ... -1.300 8.2e-03
lung carcinoma 1.500 2.1e-17
oligodendroglioma -1.300 4.5e-02
primitive neuroectodermal tumor 1.400 5.3e-03

Gene RIF (13)

AA Sequence

MATSHRVAKLVASSLQTPVNPITGARVAQYEREDPLKALAAAEAILEDEEEEKVAQPAGASADLNTSFSG      1 - 70
VDEHAPISYEDFVNFPDIHHSNEEYFKKVEELKAAHIETMAKLEKMYQDKLHLKEVQPVVIREDSLSDSS     71 - 140
RSVSEKNSYHPVSLMTSFSEPDLGQSSSLYVSSSEEELPNLEKEYPRKNRMMTYAKELINNMWTDFCVED    141 - 210
YIRCKDTGFHAAEKRRKKRKEWVPTITVPEPFQMMIREQKKKEESMKSKSDIEMVHKALKKQEEDPEYKK    211 - 280
KFRANPVPASVFLPLYHDLVKQKEERRRSLKEKSKEALLASQKPFKFIAREEQKRAAREKQLRDFLKYKK    281 - 350
KTNRFKARPIPRSTYGSTTNDKLKEEELYRNLRTQLRAQEHLQNSSPLPCRSACGCRNPRCPEQAVKLKC    351 - 420
KHKVRCPTPDFEDLPERYQKHLSEHKSPKLLTVCKPFDLHASPHASIKREKILADIEADEENLKETRWPY    421 - 490
LSPRRKSPVRCAGVNPVPCNCNPPVPTVSSRGREQAVRKSEKERMREYQRELEEREEKLKKRPLLFERVA    491 - 560
QKNARMAAEKHYSNTLKALGISDEFVSKKGQSGKVLEYFNNQETKSVTEDKESFNEEEKIEERENGEENY    561 - 630
FIDTNSQDSYKEKDEANEESEEEKSVEESH                                            631 - 660
//

Text Mined References (29)

PMID Year Title