Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.33

Knowledge Summary


No data available


Accession P0CG43


 Compartment GO Term (1)

AA Sequence

SSGQHGGRVNLVFFIDSPTVIAVPDLQCPTKYSGILY                                     351 - 387

Text Mined References (2)

PMID Year Title