Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.58
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.700 1.1e-05
astrocytoma -1.400 1.2e-07
Astrocytoma, Pilocytic -1.100 3.0e-03
atypical teratoid / rhabdoid tumor -3.700 3.8e-12
cystic fibrosis 1.339 6.8e-04
ependymoma -2.300 2.4e-09
facioscapulohumeral dystrophy 1.800 2.7e-02
fibroadenoma 1.900 4.7e-04
glioblastoma -2.400 1.2e-07
group 4 medulloblastoma -1.700 8.3e-04
interstitial cystitis -1.900 7.1e-03
malignant mesothelioma -4.400 1.3e-09
medulloblastoma, large-cell -3.600 3.2e-06
osteosarcoma -1.379 1.3e-02
ovarian cancer -3.200 7.5e-12
primitive neuroectodermal tumor -1.900 1.1e-02
spina bifida -2.409 4.2e-02

Synonym

Accession B1AL88 B2RUV1 B7Z334
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MTRGAWMCRQYDDGLKIWLAAPRENEKPFIDSERAQKWRLSLASLLFFTVLLSDHLWFCAEAKLTRARDK      1 - 70
EHQQQQRQQQQQQQQQRQRQQQQQQRRQQEPSWPALLASMGESSPAAQAHRLLSASSSPTLPPSPGDGGG     71 - 140
GGGKGNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQCFTVENADAVCARNWSRGAAGGDGQEVRSK    141 - 210
HPTPLWNLSDFYLSFCNSYTLWELFSGLSSPNTLNCSLDVVLKEGGEMTTCRQCVEAYQDYDHHAQEKYE    211 - 280
EFESVLHKYLQSEEYSVKSCPEDCKIVYKAWLCSQYFEVTQFNCRKTIPCKQYCLEVQTRCPFILPDNDE    281 - 350
VIYGGLSSFICTGLYETFLTNDEPECCDVRREEKSNNPSKGTVEKSGSCHRTSLTVSSATRLCNSRLKLC    351 - 420
VLVLILLHTVLTASAAQNTAGLSFGGINTLEENSTNEE                                    421 - 458
//

Text Mined References (17)

PMID Year Title