Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.33
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -4.400 1.3e-09
astrocytoma -1.400 1.2e-07
glioblastoma -3.200 1.0e-03
osteosarcoma -1.379 1.3e-02
posterior fossa group B ependymoma -2.600 1.3e-06
medulloblastoma -2.000 1.8e-03
cystic fibrosis 2.517 2.0e-05
atypical teratoid / rhabdoid tumor -4.300 1.1e-08
medulloblastoma, large-cell -3.700 6.6e-05
primitive neuroectodermal tumor -1.900 1.1e-02
fibroadenoma 1.900 4.7e-04
interstitial cystitis -2.000 5.0e-03
adult high grade glioma -2.700 1.1e-05
pilocytic astrocytoma -1.100 4.5e-03
spina bifida -2.409 4.2e-02
ovarian cancer -3.200 7.5e-12
facioscapulohumeral dystrophy 1.800 2.7e-02

Synonym

Accession B1AL88 B2RUV1 B7Z334
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTRGAWMCRQYDDGLKIWLAAPRENEKPFIDSERAQKWRLSLASLLFFTVLLSDHLWFCAEAKLTRARDK      1 - 70
EHQQQQRQQQQQQQQQRQRQQQQQQRRQQEPSWPALLASMGESSPAAQAHRLLSASSSPTLPPSPGDGGG     71 - 140
GGGKGNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQCFTVENADAVCARNWSRGAAGGDGQEVRSK    141 - 210
HPTPLWNLSDFYLSFCNSYTLWELFSGLSSPNTLNCSLDVVLKEGGEMTTCRQCVEAYQDYDHHAQEKYE    211 - 280
EFESVLHKYLQSEEYSVKSCPEDCKIVYKAWLCSQYFEVTQFNCRKTIPCKQYCLEVQTRCPFILPDNDE    281 - 350
VIYGGLSSFICTGLYETFLTNDEPECCDVRREEKSNNPSKGTVEKSGSCHRTSLTVSSATRLCNSRLKLC    351 - 420
VLVLILLHTVLTASAAQNTAGLSFGGINTLEENSTNEE                                    421 - 458
//

Text Mined References (17)

PMID Year Title
25208829 2014 Genome-wide association study of vitamin D levels in children: replication in the Western Australian Pregnancy Cohort (Raine) study.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23738518 2013 A genome-wide association study for reading and language abilities in two population cohorts.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21079607 2011 A genome-wide association study on common SNPs and rare CNVs in anorexia nervosa.
20800221 2010 Genome-wide association scan of trait depression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8325628 1993 Novel triplet repeat containing genes in human brain: cloning, expression, and length polymorphisms.