Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.000 6.3e-04
Astrocytoma, Pilocytic -2.100 3.1e-07
atypical teratoid / rhabdoid tumor -2.800 1.3e-13
ependymoma -2.000 3.1e-16
glioblastoma -1.900 1.1e-08
group 3 medulloblastoma -2.100 5.3e-03
medulloblastoma, large-cell -2.800 1.5e-05
osteosarcoma -1.773 5.2e-07
ovarian cancer -1.600 2.3e-13
primitive neuroectodermal tumor -2.700 2.0e-06
progressive supranuclear palsy 1.600 1.9e-02
psoriasis -1.600 3.4e-25
subependymal giant cell astrocytoma -1.988 3.6e-02

AA Sequence

MGCAYSCCLEVCCGEDEIVYPRMPGESTVCHREREKPITYHWYHWHPGHIYPRVASMEDYDEDLVQEASS      1 - 70
EDVLGVHMVDKDTERDIEMKRQLRRLRELHLYSTWKKYQEAMKTSLGVPQCERDEGSLGKPLCPPEILSE     71 - 140
TLPGSVKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVAHADTGIQTNGDLEDLEEHGPGQTVSEEATEVH    141 - 210
MMEGDPDTLAELLIRDVLQELSSYNGEEEDPEEVKTSLGVPQRGDLEDLEEHVPGQTVSEEATGVHMMQV    211 - 280
DPATPAKSDLEDLEEHVPGQTVSEEATGVHMMQVDPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEK    281 - 350
TKVEEEVKTRKPKKKTRKPSKKSRWNVLKCWDIFNIF                                     351 - 387
//

Text Mined References (6)

PMID Year Title