Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.47
PubTator Score 0.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -1.100 3.3e-02
Astrocytoma, Pilocytic -1.100 1.1e-03
Atopic dermatitis -1.200 4.1e-03
atypical teratoid/rhabdoid tumor 1.400 4.2e-02
Breast cancer -2.500 1.5e-12
breast carcinoma -1.700 1.6e-14
cystic fibrosis -1.228 4.5e-05
Endometriosis -1.040 4.6e-02
gastric carcinoma -2.700 1.8e-02
interstitial cystitis -1.400 2.6e-02
intraductal papillary-mucinous adenoma (... -5.200 1.1e-06
intraductal papillary-mucinous carcinoma... -5.400 7.0e-07
intraductal papillary-mucinous neoplasm ... -5.500 6.3e-05
invasive ductal carcinoma -1.366 1.6e-02
lung adenocarcinoma -2.400 3.3e-17
medulloblastoma, large-cell -1.100 4.9e-02
non-small cell lung cancer -3.724 1.4e-36
ovarian cancer -2.000 5.4e-03
pancreatic cancer -2.700 6.5e-05
primary pancreatic ductal adenocarcinoma -1.340 2.0e-02
psoriasis -1.200 1.0e-05

Synonym

Accession Q6UX46 B5MC76
Symbols AUGA
FAM150B
PRO1097
RGPG542

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MRGPGHPLLLGLLLVLGAAGRGRGGAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGR      1 - 70
AEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTR     71 - 140
LAVSPVCMEDKQ                                                              141 - 152
//

Text Mined References (6)

PMID Year Title