Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.72
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MRPLKPGAPLPALFLLALALSPHGAHGRPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDS      1 - 70
NLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT                71 - 129
//

Text Mined References (7)

PMID Year Title