Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.300 3.6e-03
Atopic dermatitis -1.400 4.9e-05
atypical teratoid / rhabdoid tumor -1.400 3.4e-02
chronic rhinosinusitis -1.202 1.3e-02
ductal carcinoma in situ -1.400 4.5e-02
ependymoma -1.400 2.4e-04
gastric carcinoma -1.200 3.3e-02
glioblastoma -1.300 3.3e-04
group 4 medulloblastoma -1.700 3.2e-05
interstitial cystitis -1.200 2.0e-03
intraductal papillary-mucinous adenoma (... 1.400 2.0e-03
invasive ductal carcinoma -2.200 1.3e-03
lung carcinoma 1.400 5.9e-09
medulloblastoma, large-cell -1.700 2.1e-02
nasopharyngeal carcinoma -1.100 1.2e-05
non-small cell lung cancer -1.016 3.2e-08
osteosarcoma -1.148 3.8e-02
psoriasis -1.300 1.7e-10
subependymal giant cell astrocytoma 1.248 2.9e-02

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MKAAVLDLGSLLAKLFETSTAPPAGPSSRPSGGAAAAGSGGSRAGTPLGTAPTLLRALAPDSPSASRRSP      1 - 70
APLLSSPYSRGSAASRAAGAVGTLLSWPSSPRAGKAPPQPPTPSGGGCSPARLVVPARPPSGPGGVWAAL     71 - 140
PRNPLQPGPGERELGACVAPGAGPRTLFLTLPDIGEEGASDGDSGDGEARGLSEGRRRHGFTVRSKDSLP    141 - 210
THFTRNVQKAIDKYTCKSLSSFSSSGSHTPTGAHTSWSGSATQSSTTGSSTERGSVYSWRDDEFDEASSQ    211 - 280
SVQRLLWEVEEMLFEGKVNPQTQSLLAECGEWTRRSLHLRVLGRQLILPTDKGVQHFQGSTPASAVHRPP    281 - 350
LSACGHSSNIRELCISGSQIVPAALSASALPGPDDTGVADLTARSSLEEEVYHVDGKIEEYFAFDRKEDD    351 - 420
DECLEQKPAQPGRKWRKLGLPPVSPRDCVKDAVAAEVFDHVWTNMVELLEELIRKHWETTLTEGKKQRET    421 - 490
LKVAGNRFPHVLVPHAHADGASGPPSGHAEAHGISLASRLNPPQIHHFSSSFYSDMNGVMTIQAKPLQRR    491 - 560
PAYFADRTQNEKEDKASGGGAGALSSAPHRLGRASDTHGLSPSAKKTPVPWRLPSLASDSQRLKTPNIYS    561 - 630
DEVLRGTKLPTGVDHMASPLVQTSRSRFPPLVTETRGQNTAVPGCRLVSYRGRHLQNRVLSAMPDGTERS    631 - 700
RLRERTATLERLSRPSTTHTFRQSDTPRKSSLTQMEFAAHTWTGQSILTGSQYVPKSFQRTTLTFKRRFQ    701 - 770
VTS                                                                       771 - 773
//

Text Mined References (8)

PMID Year Title