Property Summary

NCBI Gene PubMed Count 33
PubMed Score 18.40
PubTator Score 19.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Pulmonary Fibrosis, Idiopathic 12

Expression

  Differential Expression (37)

Disease log2 FC p
Rheumatoid Arthritis 1.600 1.2e-02
pancreatic cancer -1.500 2.7e-03
Multiple myeloma 2.650 7.5e-04
malignant mesothelioma -3.500 1.7e-08
psoriasis -1.900 1.9e-13
cystic fibrosis 1.744 5.9e-06
atypical teratoid / rhabdoid tumor -2.200 1.4e-04
glioblastoma -1.800 7.3e-04
group 4 medulloblastoma -1.700 6.3e-03
medulloblastoma, large-cell 1.800 1.8e-06
primitive neuroectodermal tumor -1.300 1.0e-02
Duchenne muscular dystrophy 1.253 8.5e-05
autosomal dominant Emery-Dreifuss muscul... 1.343 1.5e-02
juvenile dermatomyositis 1.634 4.1e-11
Amyotrophic Lateral Sclerosis 1.192 1.1e-04
acute quadriplegic myopathy 2.003 3.4e-05
primary pancreatic ductal adenocarcinoma -1.564 6.7e-03
colon cancer -2.200 1.7e-02
lung cancer -2.600 6.2e-06
breast carcinoma -1.800 1.9e-05
fibroadenoma -1.400 7.8e-03
interstitial cystitis -1.100 1.8e-05
pancreatic carcinoma 1.200 6.2e-03
aldosterone-producing adenoma -1.106 2.1e-02
invasive ductal carcinoma -2.200 6.0e-03
lung adenocarcinoma 1.369 4.8e-04
Endometriosis -1.521 1.5e-02
Breast cancer -2.100 1.1e-12
lung carcinoma -1.300 4.9e-15
Alzheimer's disease 1.200 4.0e-02
Pick disease 1.800 3.2e-05
progressive supranuclear palsy 1.300 3.7e-02
homozygous familial hypercholesterolemia 1.576 4.0e-02
ductal carcinoma in situ -1.900 6.7e-04
ulcerative colitis -1.200 1.3e-04
ovarian cancer -2.600 2.3e-06
dermatomyositis 1.700 2.0e-03

Gene RIF (18)

PMID Text
26527870 FAM13A - candidate gene for Chronic Obstructive Pulmonary Disease identified by Genome-wide association studies.
26310313 This study confirms that the IREB2 variants contribute to an increased risk of lung cancer, whereas FAM13A predisposes to increased susceptibility to chronic obstructive pulmonary disease.
25609086 Fam13a may contribute to human lung diseases.
25608829 Data indicate that the FAM13A protein CTGA haplotypes interacted with heavy smoking to affect the risk of reduced pulmonary function.
25163686 This review gives a brief summary of the current knowledge of FAM13A, and demonstrates the necessity to resolve its biological function besides its well accepted genetic contribution.
24651745 CT quantitative analysis of lung parenchyma is very well correlated with COPD candidate gene FAM13A.
24587150 Haplotypes carrying major alleles of rs7671167 (C) of FAM13A had a protective effect on lung function amongst South Indian male smokers with COPD.
23891779 the FAM13A locus might be a contributor to chronic obstructive pulmonary disease susceptibility in Chinese Han population.
23169000 FAM13A1 is one of the top hub genes associated with human Treg suppressor function. See Table 1 of the publication.
22027142 these results support that FAM13A rs2869967 and XRCC5 rs3821104 are associated with COPD in Chinese Han population.
20656943 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
20173748 A new susceptibility locus at 4q22.1 in FAM13A and replicated this association in one case-control group (n = 1,006) and two family-based cohorts.
20173748 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20010835 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGAGALAICQSKAAVRLKEDMKKIVAVPLNEQKDFTYQKLFGVSLQELERQGLTENGIPAVVWNIVEYLT      1 - 70
QHGLTQEGLFRVNGNVKVVEQLRLKFESGVPVELGKDGDVCSAASLLKLFLRELPDSLITSALQPRFIQL     71 - 140
FQDGRNDVQESSLRDLIKELPDTHYCLLKYLCQFLTKVAKHHVQNRMNVHNLATVFGPNCFHVPPGLEGM    141 - 210
KEQDLCNKIMAKILENYNTLFEVEYTENDHLRCENLARLIIVKEVYYKNSLPILLTRGLERDMPKPPPKT    211 - 280
KIPKSRSEGSIQAHRVLQPELSDGIPQLSLRLSYRKACLEDMNSAEGAISAKLVPSSQEDERPLSPFYLS    281 - 350
AHVPQVSNVSATGELLERTIRSAVEQHLFDVNNSGGQSSEDSESGTLSASSATSARQRRRQSKEQDEVRH    351 - 420
GRDKGLINKENTPSGFNHLDDCILNTQEVEKVHKNTFGCAGERSKPKRQKSSTKLSELHDNQDGLVNMES    421 - 490
LNSTRSHERTGPDDFEWMSDERKGNEKDGGHTQHFESPTMKIQEHPSLSDTKQQRNQDAGDQEESFVSEV    491 - 560
PQSDLTALCDEKNWEEPIPAFSSWQRENSDSDEAHLSPQAGRLIRQLLDEDSDPMLSPRFYAYGQSRQYL    561 - 630
DDTEVPPSPPNSHSFMRRRSSSLGSYDDEQEDLTPAQLTRRIQSLKKKIRKFEDRFEEEKKYRPSHSDKA    631 - 700
ANPEVLKWTNDLAKFRRQLKESKLKISEEDLTPRMRQRSNTLPKSFGSQLEKEDEKKQELVDKAIKPSVE    701 - 770
ATLESIQRKLQEKRAESSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVTKNERQVMKPLYDRYRL    771 - 840
VKQILSRANTIPIIGSPSSKRRSPLLQPIIEGETASFFKEIKEEEEGSEDDSNVKPDFMVTLKTDFSARC    841 - 910
FLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFEDNFFRQN    911 - 980
GRNVQKEDRTPMAEEYSEYKHIKAKLRLLEVLISKRDTDSKSM                               981 - 1023
//

Text Mined References (39)

PMID Year Title
26527870 2015 Candidate genes for COPD: current evidence and research.
26310313 2015 Susceptibility loci in lung cancer and COPD: association of IREB2 and FAM13A with pulmonary diseases.
25609086 2015 Regulation of nuclear-cytoplasmic shuttling and function of Family with sequence similarity 13, member A (Fam13a), by B56-containing PP2As and Akt.
25608829 2015 Identification of FAM13A gene associated with the ratio of FEV1 to FVC in Korean population by genome-wide association studies including gene-environment interactions.
25241909 2014 Genetic susceptibility for chronic bronchitis in chronic obstructive pulmonary disease.
25163686 2014 Moving beyond genetics: is FAM13A a major biological contributor in lung physiology and chronic lung diseases?
25101718 2015 IREB2 and GALC are associated with pulmonary artery enlargement in chronic obstructive pulmonary disease.
24651745 Quantitative analysis of lungs and airways with CT in subjects with the chronic obstructive pulmonary disease (COPD) candidate FAM13A gene: case control study for CT quantification in COPD risk gene.
24621683 2014 Risk loci for chronic obstructive pulmonary disease: a genome-wide association study and meta-analysis.
24587150 2014 Genetic determinants of chronic obstructive pulmonary disease in South Indian male smokers.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23891779 2013 Association of FAM13A polymorphisms with COPD and COPD-related phenotypes in Han Chinese.
23583980 2013 Genome-wide association study identifies multiple susceptibility loci for pulmonary fibrosis.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23169000 2012 PLAU inferred from a correlation network is critical for suppressor function of regulatory T cells.
22080838 2012 A genome-wide association study of COPD identifies a susceptibility locus on chromosome 19q13.
22027142 2011 Genetic analysis of IREB2, FAM13A and XRCC5 variants in Chinese Han patients with chronic obstructive pulmonary disease.
20656943 2010 Loci identified by genome-wide association studies influence different disease-related phenotypes in chronic obstructive pulmonary disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20173748 2010 Variants in FAM13A are associated with chronic obstructive pulmonary disease.
20010835 2010 Meta-analyses of genome-wide association studies identify multiple loci associated with pulmonary function.
19875103 2010 Genomewide association study of movement-related adverse antipsychotic effects.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15234000 2004 Cloning and characterization of FAM13A1--a gene near a milk protein QTL on BTA6: evidence for population-wide linkage disequilibrium in Israeli Holsteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9314494 1997 High-resolution mapping and transcript identification at the progressive epilepsy with mental retardation locus on chromosome 8p.