Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.29
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
chronic lymphocytic leukemia 1.123 7.0e-03
psoriasis -2.100 1.2e-05
osteosarcoma -2.653 2.6e-05
group 4 medulloblastoma -1.700 8.8e-05
atypical teratoid / rhabdoid tumor -1.400 6.5e-06
medulloblastoma, large-cell -2.300 8.0e-05
primitive neuroectodermal tumor -1.200 4.5e-04
acute quadriplegic myopathy 1.117 5.3e-08
lung cancer 1.500 5.1e-05
adult high grade glioma -1.100 1.9e-04
non primary Sjogren syndrome sicca 1.100 4.3e-02
subependymal giant cell astrocytoma -1.248 1.5e-02
ulcerative colitis -1.100 4.3e-04
ovarian cancer -1.700 3.8e-07

Gene RIF (1)

PMID Text
19212629 MAG-2 may be a novel causal gene for lung cancer invasion and metastasis.

AA Sequence

MASGGGGGNTGAGGGPGMGLSLGLGLGLSLGMSEATSEAEEEAATAEAVGRLATTLWLRLRGWEAVLAAA      1 - 70
QRLLVWEKPLHSLVTAAALNGLFWLLSSSSLRPFFLLSVSLLAYFLLDLWQPRFLPDVSASSPEEPHSDS     71 - 140
EGAGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCSGCAVLAVLGHYVPGIMIS    141 - 210
YIVLLSILLWPLVVYHELIQRMYTRLEPLLMQLDYSMKAEANALHHKHDKRKRQGKNAPPGGDEPLAETE    211 - 280
SESEAELAGFSPVVDVKKTALALAITDSELSDEEASILESGGFSVSRATTPQLTDVSEDLDQQSLPSEPE    281 - 350
ETLSRDLGEGEEGELAPPEDLLGRPQALSRQALDSEEEEEDVAAKETLLRLSSPLHFVNTHFNGAGSPPD    351 - 420
GVKCSPGGPVETLSPETVSGGLTALPGTLSPPLCLVGSDPAPSPSILPPVPQDSPQPLPAPEEEEALTTE    421 - 490
DFELLDQGELEQLNAELGLEPETPPKPPDAPPLGPDIHSLVQSDQEAQAVAEP                     491 - 543
//

Text Mined References (21)

PMID Year Title
26040720 2015 Regulation of endoplasmic reticulum turnover by selective autophagy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21310131 2003 [Identification of novel metastasis associated genes MAG-1 and MAG-2].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19212629 2009 MAG-2 promotes invasion, mobility and adherence capability of lung cancer cells by MMP-2, CD44 and intracellular calcium in vitro.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18088087 2008 Phosphoproteome of resting human platelets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.