Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.79
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.117 5.3e-08
adult high grade glioma -1.100 1.9e-04
atypical teratoid / rhabdoid tumor -1.400 6.5e-06
Chronic Lymphocytic Leukemia 1.123 7.0e-03
group 4 medulloblastoma -1.400 1.5e-05
lung cancer 1.200 9.9e-03
medulloblastoma, large-cell -1.100 5.0e-03
non primary Sjogren syndrome sicca 1.100 4.3e-02
osteosarcoma -1.393 6.1e-04
ovarian cancer -1.700 3.8e-07
primitive neuroectodermal tumor -1.200 4.5e-04
psoriasis -2.100 1.2e-05
subependymal giant cell astrocytoma -1.248 1.5e-02
ulcerative colitis -1.100 4.3e-04

Gene RIF (1)

AA Sequence

MASGGGGGNTGAGGGPGMGLSLGLGLGLSLGMSEATSEAEEEAATAEAVGRLATTLWLRLRGWEAVLAAA      1 - 70
QRLLVWEKPLHSLVTAAALNGLFWLLSSSSLRPFFLLSVSLLAYFLLDLWQPRFLPDVSASSPEEPHSDS     71 - 140
EGAGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCSGCAVLAVLGHYVPGIMIS    141 - 210
YIVLLSILLWPLVVYHELIQRMYTRLEPLLMQLDYSMKAEANALHHKHDKRKRQGKNAPPGGDEPLAETE    211 - 280
SESEAELAGFSPVVDVKKTALALAITDSELSDEEASILESGGFSVSRATTPQLTDVSEDLDQQSLPSEPE    281 - 350
ETLSRDLGEGEEGELAPPEDLLGRPQALSRQALDSEEEEEDVAAKETLLRLSSPLHFVNTHFNGAGSPPD    351 - 420
GVKCSPGGPVETLSPETVSGGLTALPGTLSPPLCLVGSDPAPSPSILPPVPQDSPQPLPAPEEEEALTTE    421 - 490
DFELLDQGELEQLNAELGLEPETPPKPPDAPPLGPDIHSLVQSDQEAQAVAEP                     491 - 543
//

Text Mined References (23)

PMID Year Title