Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.83
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung adenocarcinoma 2627 1.4e-16
ovarian cancer 8297 2.0e-07
osteosarcoma 7766 7.1e-07
interstitial cystitis 2237 2.0e-04
lung cancer 4607 5.3e-03
glioblastoma 5635 5.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
CHARGE syndrome 25 3.988 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.100 5.4e-03
interstitial cystitis 1.300 2.0e-04
lung adenocarcinoma -1.600 1.4e-16
lung cancer -2.100 5.3e-03
osteosarcoma -1.617 7.1e-07
ovarian cancer 1.200 2.0e-07

Gene RIF (1)

AA Sequence

MDETQGPLAMTVHLLANSGHGSLLQRTLDQLLDCICPEVRLFQVSERASPVKYCEKSHSKRSRFPGMSVL      1 - 70
LFLHESPGEDRLFRVLDSLQHSPWQCYPTQDTRGRLCPYFFANQEFYSLDSQLPIWGVRQVHCGSEILRV     71 - 140
TLYCSFDNYEDAIRLYEMILQREATLQKSNFCFFVLYASKSFALQLSLKQLPPGMSVDPKESSVLQFKVQ    141 - 210
EIGQLVPLLPNPCMPISSTRWQTQDYDGNKILLQVQLNPELGVKNGILGAGMLPLGSRLTSVSAKRTSEP    211 - 280
RSQRNQGKRSQGHSLELPEPSGSPTSDRCAGTSWKSPGRSFQVSSPAMGAHLHLSSHHLESGARMKVLNR    281 - 350
ENSFQKLEAETNVDTGLTIINSEPRQTYFGGFPRDLQTSQPPFCLPASSLGVATSKNNSVLKERVSPLPL    351 - 420
AGQRDLGTRKTISECLLHLQVQGEEKEEDEEEFFI                                       421 - 455
//

Text Mined References (11)

PMID Year Title