Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.093 2.3e-06
atypical teratoid / rhabdoid tumor 1.200 1.4e-02
tuberculosis 1.400 2.0e-05
posterior fossa group B ependymoma 1.700 1.0e-05

Synonym

Accession Q6P4D5 F5H036 Q8WVK9
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 Compartment GO Term (0)

AA Sequence

MAQEKMKLGFKSLPSSTTADGNILRRVNSAPLINGLGFNSQVLQADMLRIRTNRTTFRNRRSLLLPPPPF      1 - 70
HGSISRLHQIKQEEAMDLINRETMSEWKLQSEIQISHSWEEGLKLVKWHFNINQKRFSKAQPTCFLLILP     71 - 140
NCQKIMCIYFQLLLMETTAMLDLLVIRQLKSALSQTLLCHLLILVLICSSRQTFN                   141 - 195
//

Text Mined References (5)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.