Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.4e-02
osteosarcoma -2.093 2.3e-06
posterior fossa group B ependymoma 1.700 1.0e-05
tuberculosis 1.400 2.0e-05

Synonym

Accession Q6P4D5 F5H036 Q8WVK9
Symbols

Gene

  Ortholog (1)

Species Source Disease
Inparanoid OMA EggNOG

 Compartment GO Term (0)

AA Sequence

MAQEKMKLGFKSLPSSTTADGNILRRVNSAPLINGLGFNSQVLQADMLRIRTNRTTFRNRRSLLLPPPPF      1 - 70
HGSISRLHQIKQEEAMDLINRETMSEWKLQSEIQISHSWEEGLKLVKWHFNINQKRFSKAQPTCFLLILP     71 - 140
NCQKIMCIYFQLLLMETTAMLDLLVIRQLKSALSQTLLCHLLILVLICSSRQTFN                   141 - 195
//

Text Mined References (5)

PMID Year Title