Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.0e-07
osteosarcoma 7950 1.4e-05
primary pancreatic ductal adenocarcinoma 1109 2.0e-02
Disease Target Count Z-score Confidence
Brain glioma 7 3.626 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.229 1.4e-05
ovarian cancer -1.500 1.0e-07
primary pancreatic ductal adenocarcinoma 1.002 2.0e-02

AA Sequence

MGKTKDIGDDDTVASEFWSGALSQPSSVPTRPRTPNRDSWRRAWAARGLHPRPSILQPGPARLSRARAGG      1 - 70
TRCPQRRHGRATFCALGRGIGVRRGPGPRPARIPGLTLTWKRMSARRMQWAMQTGGRNQTFGGGVPLFWT     71 - 140
WLTICCAVWRSLPCRLTHSCSRAFSSAPLKKTKSSMLPPKQALASAARNLCRGAGCNRQAVAGQLLPSTW    141 - 210
SLHAHGLAKEAPILPVKKISRSCSVNNKVSKKTTKPPTLRSFLSPI                            211 - 256
//

Text Mined References (8)

PMID Year Title