Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.25
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.1e-10
ovarian cancer 8520 2.0e-06
malignant mesothelioma 3232 2.6e-06
ependymoma 4679 3.2e-05
osteosarcoma 7950 1.8e-04
inflammatory breast cancer 286 1.4e-03
group 3 medulloblastoma 4104 8.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.100 3.2e-05
group 3 medulloblastoma 1.400 8.4e-03
inflammatory breast cancer -1.400 1.4e-03
malignant mesothelioma -1.100 2.6e-06
osteosarcoma -2.923 1.8e-04
ovarian cancer -1.300 2.0e-06
psoriasis -1.500 5.1e-10

 Compartment GO Term (2)

AA Sequence

MAGAAAGGRGGGAWGPGRGGAGGLRRGCSPPAPAGSPRAGLQPLRATIPFQLQQPHQRRDGGGRAASVPC      1 - 70
SVAPEKSVCRPQPLQVRRTFSLDTILSSYLLGQWPRDADGAFTCCTNDKATQTPLSWQELEGERASSCAH     71 - 140
KRSASWGSTDHRKEISKLKQQLQRTKLSRSGKEKERGSPLLGDHAVRGALRASPPSFPSGSPVLRLSPCL    141 - 210
HRSLEGLNQELEEVFVKEQGEEELLRILDIPDGHRAPAPPQSGSCDHPLLLLEPGNLASSPSMSLASPQP    211 - 280
CGLASHEEHRGAAEELASTPNDKASSPGHPAFLEDGSPSPVLAFAASPRPNHSYIFKREPPEGCEKVRVF    281 - 350
EEATSPGPDLAFLTSCPDKNKVHFNPTGSAFCPVNLMKPLFPGMGFIFRNCPSNPGSPLPPASPRPPPRK    351 - 420
DPEASKASPLPFEPWQRTPPSEEPVLFQSSLMV                                         421 - 453
//

Text Mined References (8)

PMID Year Title