Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.63
PubTator Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.100 5.6e-03
Astrocytoma, Pilocytic 2.200 2.7e-09
atypical teratoid / rhabdoid tumor 1.300 3.8e-03
colon cancer -1.600 1.3e-03
ependymoma 1.100 7.5e-05
glioblastoma 1.500 6.0e-06
intraductal papillary-mucinous adenoma (... 1.200 2.2e-03
intraductal papillary-mucinous carcinoma... 1.700 3.1e-03
lung adenocarcinoma 1.100 6.0e-07
lung carcinoma -1.500 1.5e-17
malignant mesothelioma -2.200 3.9e-08
osteosarcoma 1.427 3.8e-03
ovarian cancer -2.200 7.4e-08
pituitary cancer -1.500 1.3e-05
sonic hedgehog group medulloblastoma 1.100 5.9e-03
subependymal giant cell astrocytoma 1.719 2.9e-02

Gene RIF (5)

AA Sequence

MSDDAGDTLATGDKAEVTEMPNSDSLPEDAEVHCDSAAVSHEPTPADPRGEGHENAAVQGAGAAAIGPPV      1 - 70
QPQDANALEPPLNGDVTEDTLAECIDSVSLEAEPRSEIPLQEQNYLAVDSPPSGGGWAGWGSWGKSLLSS     71 - 140
ASATVGHGLTAVKEKAGATLRIHGVNSGSSEGAQPNTENGVPEITDAATDQGPAESPPTSPSSASRGMLS    141 - 210
AITNVVQNTGKSVLTGGLDALEFIGKKTMNVLAESDPGFKRTKTLMERTVSLSQMLREAKEKEKQRLAQQ    211 - 280
LTMERTAHYGMLFDEYQGLSHLEALEILSNESESKVQSFLASLDGEKLELLKNDLISIKDIFAAKELENE    281 - 350
ENQEEQGLEEKGEEFARMLTELLFELHVAATPDKLNKAMKRAHDWVEEDQTVVSVDVAKVSEEETKKEEK    351 - 420
EEKSQDPQEDKKEEKKTKTIEEVYMSSIESLAEVTARCIEQLHKVAELILHGQEEEKPAQDQAKVLIKLT    421 - 490
TAMCNEVASLSKKFTNSLTTVGSNKKAEVLNPMISSVLLEGCNSTTYIQDAFQLLLPVLQVSHIQTSCLK    491 - 560
AQP                                                                       561 - 563
//

Text Mined References (22)

PMID Year Title