Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.48
PubTator Score 9.86

Knowledge Summary


No data available


  Differential Expression (7)

Disease log2 FC p
Breast cancer 1.200 4.2e-10
intraductal papillary-mucinous carcinoma... 1.300 2.0e-02
intraductal papillary-mucinous neoplasm ... 1.600 4.1e-03
lung adenocarcinoma 1.400 3.0e-09
non-small cell lung carcinoma 1.800 1.7e-23
osteosarcoma 1.744 2.2e-03
psoriasis 2.000 4.4e-89

 Compartment GO Term (3)

Gene RIF (2)

AA Sequence

LYKSLNDEKLETYDEEKGKQESSLQDHQIEPMEC                                        701 - 734

Text Mined References (10)

PMID Year Title