Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.64
PubTator Score 6.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.900 8.3e-06
astrocytoma 1.200 1.8e-16
Astrocytoma, Pilocytic 1.600 1.2e-08
atypical teratoid / rhabdoid tumor 1.800 2.2e-06
colon cancer 1.300 2.2e-02
ependymoma 1.800 1.3e-13
glioblastoma 1.900 2.3e-11
intraductal papillary-mucinous adenoma (... 1.100 3.0e-03
intraductal papillary-mucinous carcinoma... 1.300 2.2e-03
intraductal papillary-mucinous neoplasm ... 1.300 6.6e-03
lung cancer -2.600 3.1e-04
lung carcinoma -1.100 1.9e-18
osteosarcoma -1.922 4.2e-06
primitive neuroectodermal tumor 1.300 1.8e-02
sonic hedgehog group medulloblastoma 1.100 9.3e-03
subependymal giant cell astrocytoma 2.467 3.7e-03
tuberculosis 1.700 2.8e-06

Gene RIF (5)

AA Sequence

MSCKKQRSRKHSVNEKCNMKIEHYFSPVSKEQQNNCSTSLMRMESRGDPRATTNTQAQRFHSPKKNPEDQ      1 - 70
TMPQNRTIYVTLKVNHRRNQDMKLKLTHSENSSLYMALNTLQAVRKEIETHQGQEMLVRGTEGIKEYINL     71 - 140
GMPLSCFPEGGQVVITFSQSKSKQKEDNHIFGRQDKASTECVKFYIHAIGIGKCKRRIVKCGKLHKKGRK    141 - 210
LCVYAFKGETIKDALCKDGRFLSFLENDDWKLIENNDTILESTQPVDELEGRYFQVEVEKRMVPSAAASQ    211 - 280
NPESEKRNTCVLREQIVAQYPSLKRESEKIIENFKKKMKVKNGETLFELHRTTFGKVTKNSSSIKVVKLL    281 - 350
VRLSDSVGYLFWDSATTGYATCFVFKGLFILTCRHVIDSIVGDGIEPSKWATIIGQCVRVTFGYEELKDK    351 - 420
ETNYFFVEPWFEIHNEELDYAVLKLKENGQQVPMELYNGITPVPLSGLIHIIGHPYGEKKQIDACAVIPQ    421 - 490
GQRAKKCQERVQSKKAESPEYVHMYTQRSFQKIVHNPDVITYDTEFFFGASGSPVFDSKGSLVAMHAAGF    491 - 560
AYTYQNETRSIIEFGSTMESILLDIKQRHKPWYEEVFVNQQDVEMMSDEDL                       561 - 611
//

Text Mined References (14)

PMID Year Title