Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.29
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 3.0e-03
Breast cancer -1.100 7.0e-03
cystic fibrosis 1.125 8.4e-05
glioblastoma -1.200 7.4e-03
intraductal papillary-mucinous adenoma (... 1.100 2.2e-02
malignant mesothelioma -3.900 9.5e-08
medulloblastoma -1.300 1.4e-02
medulloblastoma, large-cell -2.000 5.9e-04
oligodendroglioma 1.100 5.3e-06
ovarian cancer -1.200 7.9e-04
pituitary cancer 1.300 2.7e-04
subependymal giant cell astrocytoma -1.230 3.2e-02

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MPTETLQTGSMVKPVSPAGTFTSAVPLRILNKGPDYFRRQAEPNPKRLSAVERLEADKAKYVKSQEVINA      1 - 70
KQEPVKPAVLAKPPVCPAAKRALGSPTLKVFGNHAKTESGVQRENLKLEILKNIINSSEGSSSGSGHKHS     71 - 140
SRNWPPHRSEATDLHRHSFAESLKVYPTQGRRSPQEGGSHVGRRLLEQSAESFLHVSHSSSDIRKVTSVK    141 - 210
PLKAIPCSSSAPPLPPKPKIAAIASMKSPEADPVEPACGVSRRPSLQRSKSDLSDRYFRVDADVERFFNY    211 - 280
CGLDPEELENLGMENFARANSDIISLNFRSASMISSDCEQSQDSNSDLRNDDSANDRVPYGISAIERNAR    281 - 350
IIKWLYSIKQARESQKVSHV                                                      351 - 370
//

Text Mined References (19)

PMID Year Title