Property Summary

NCBI Gene PubMed Count 29
PubMed Score 18.32
PubTator Score 17.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
adult high grade glioma -1.100 2.1e-02
Astrocytoma, Pilocytic -1.600 1.6e-04
atypical teratoid / rhabdoid tumor -1.800 2.9e-03
Breast cancer -2.300 3.9e-02
breast carcinoma -2.000 7.7e-07
chronic rhinosinusitis -1.157 4.2e-02
colon cancer -2.300 8.0e-06
Down syndrome 1.400 1.2e-03
ductal carcinoma in situ -2.300 2.5e-05
Endometriosis -1.362 3.4e-02
ependymoma -1.200 2.3e-03
fibroadenoma -1.600 6.4e-03
glioblastoma -2.100 2.1e-04
group 3 medulloblastoma -3.500 4.1e-09
intraductal papillary-mucinous adenoma (... -1.500 9.5e-04
intraductal papillary-mucinous carcinoma... -1.600 8.3e-04
intraductal papillary-mucinous neoplasm ... -1.600 7.7e-03
invasive ductal carcinoma -3.000 2.9e-05
lung adenocarcinoma -1.500 3.8e-16
lung cancer -2.000 5.2e-03
lung carcinoma -1.700 5.8e-13
medulloblastoma, large-cell -4.600 3.2e-07
non-small cell lung cancer -3.304 1.0e-34
ovarian cancer 1.400 2.7e-03
pancreatic cancer -1.200 2.5e-05
pituitary cancer -1.800 1.0e-03
primitive neuroectodermal tumor -2.400 3.6e-03
psoriasis -1.100 1.4e-04

Gene RIF (6)

AA Sequence

MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRV      1 - 70
LEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE     71 - 140
EREL                                                                      141 - 144
//

Text Mined References (30)

PMID Year Title