Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 9.5e-05
ovarian cancer 8520 9.3e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.365 9.5e-05
ovarian cancer 1.100 9.3e-04

AA Sequence

MGGRGADAGSSGGTGPTEGYSPPAASTRAAARAKARGGGRGGRRNTTPSVPSLRGAAPRSFHPPAAMSER      1 - 70
LRPRKRRRNGNEEDNHLPPQTKRSSRNPVFQDSWDTESSGSDSGGSSSSSSSSINSPDRASGPEGSLSQT     71 - 140
MAGSSPNTPQPVPEQSALCQGLYFHINQTLREAHFHSLQHRGRPLT                            141 - 186
//

Text Mined References (8)

PMID Year Title