Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
urothelial carcinoma -2.000 1.0e-03
astrocytic glioma -1.800 1.8e-03
ependymoma -2.300 1.7e-03
oligodendroglioma -2.100 6.5e-03
glioblastoma -1.800 1.5e-06
osteosarcoma 1.625 4.8e-03
atypical teratoid / rhabdoid tumor -2.200 3.2e-07
medulloblastoma -1.300 6.4e-05
medulloblastoma, large-cell -2.800 9.5e-05
primitive neuroectodermal tumor -1.500 3.8e-04
primary pancreatic ductal adenocarcinoma 1.514 6.3e-04
tuberculosis -1.100 1.4e-04
diabetes mellitus -1.600 8.3e-03
Breast cancer 1.900 3.6e-02
adult high grade glioma -2.100 1.9e-05
pilocytic astrocytoma -1.400 1.3e-05
Pick disease -1.300 3.8e-02
gastric carcinoma 1.500 2.3e-02
ovarian cancer -2.300 1.0e-06
pancreatic cancer 1.200 3.9e-03

AA Sequence

MMKKKKFKFKVDFELEELSSVPFVNGVLFCKMRLLDGGSFTAESSREVVQANCVRWRKKFSFMCKMSASA      1 - 70
ATGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTTRRCLLEGYDTKNTRQDNSILKVLISM     71 - 140
QLMSGDPCFKTPPSTSMSIPIAGESESLQEDRKGGETLKVHLGIADLSAKSASVPDELGACGHSRTSSYA    141 - 210
SQQSKVSGYSTCHSRSSSFSELCHRRNTSVGSTSTGVESILEPCDEIEQKIAEPNLDTADKEDTASEKLS    211 - 280
RCPVKQDSVESQLKRVDDTRVDADDIVEKILQSQDFSLDSSAEEEGLRLFVGPGGSTTFGSHHLPNRVGS    281 - 350
GAYEQVVIKR                                                                351 - 360
//

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.