Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -2.100 1.9e-05
astrocytic glioma -1.800 1.8e-03
Astrocytoma, Pilocytic -1.400 2.4e-05
atypical teratoid / rhabdoid tumor -2.200 3.2e-07
Breast cancer 1.900 3.6e-02
diabetes mellitus -1.600 8.3e-03
ependymoma -2.300 1.7e-03
gastric carcinoma 1.500 2.3e-02
glioblastoma -1.200 6.5e-05
medulloblastoma -1.300 6.4e-05
medulloblastoma, large-cell -2.800 9.5e-05
oligodendroglioma -2.100 6.5e-03
osteosarcoma 1.625 4.8e-03
ovarian cancer -2.300 1.0e-06
pancreatic cancer 1.200 3.9e-03
Pick disease -1.300 3.8e-02
primary pancreatic ductal adenocarcinoma 1.514 6.3e-04
primitive neuroectodermal tumor -1.500 3.8e-04
tuberculosis -1.100 1.4e-04
urothelial carcinoma -2.000 1.0e-03

AA Sequence

MMKKKKFKFKVDFELEELSSVPFVNGVLFCKMRLLDGGSFTAESSREVVQANCVRWRKKFSFMCKMSASA      1 - 70
ATGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTTRRCLLEGYDTKNTRQDNSILKVLISM     71 - 140
QLMSGDPCFKTPPSTSMSIPIAGESESLQEDRKGGETLKVHLGIADLSAKSASVPDELGACGHSRTSSYA    141 - 210
SQQSKVSGYSTCHSRSSSFSELCHRRNTSVGSTSTGVESILEPCDEIEQKIAEPNLDTADKEDTASEKLS    211 - 280
RCPVKQDSVESQLKRVDDTRVDADDIVEKILQSQDFSLDSSAEEEGLRLFVGPGGSTTFGSHHLPNRVGS    281 - 350
GAYEQVVIKR                                                                351 - 360
//

Text Mined References (10)

PMID Year Title