Property Summary

NCBI Gene PubMed Count 32
PubMed Score 214.67
PubTator Score 21.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Gene RIF (21)

PMID Text
26398169 The interaction of TRIM21 and LFG was analyzed by co-immunoprecipitation. To examine changes in regulatory processes, western blot analyses, real-time PCR, activity of apoptotic process and flow cytometric analyses were carried out.
25922107 There are significant differences in the associations of the FAIM2 promoter methylation with sedentary behaviour and physical activity between obese and lean children.
25764978 These results suggest that the TMBIM family has comparable functions in the maintenance of intracellular Ca(2) homeostasis in a wide variety of tissues
25735388 Low KRT13 mRNA expression is associated with oral squamous cell carcinoma.
25696115 Methylation levels of the FAIM2 promoter are significantly associated with obesity and are independently associated with dyslipidaemia and its components in Chinese children.
25069766 Results indicated that FAIM2 beta-isoform is strongly expressed in breast tumour tissues. Fas sensitivity was reduced in the MCF10A breast cells expressing the FAIM2 beta-isoform.
24621099 This study highlighted the importance of two candidate genes, SH2B1 and FAIM2, in the risk of overweight/obesity.
24393375 A polymorphism in FAIM2 is associated with higher myocardial infarction risk in type-2 diabetes mellitus subjects.
24335530 Faim2 is physiologically expressed in brain in bacterial meningitis.
23924573 The rs7138803 variant of FAIM2 was found to exert no effect on obesity in a Chinese Han population.
21957071 LFG is required for proper development and survival of granular and Purkinje cells and LFG may play a role in cerebellar disorders
21935397 Analysis identified SNPs at three loci known to be associated with BMI with genome-wide confidence (P<5x10(-8); FTO, MC4R and FAIM2).
20843981 Observational study of gene-disease association. (HuGE Navigator)
20816195 Observational study of gene-disease association. (HuGE Navigator)
20336406 LFG is strongly expressed in breast cancer epithelial cells. Moreover, the overexpression of LFG correlated with tumour grade and reduced Fas sensitivity.
20215397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19851340 Data show that SNPs in SEC16B and TMEM18 were significantly associated with obesity, and the SNPs in GNPDA2, BDNF, FAIM2 and MC4R were marginally associated with obesity in Japanese.
19851340 Observational study of gene-disease association. (HuGE Navigator)
19812171 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18440869 The tmbim2 may participate in cell death regulation by interacting with proteins of Bcl-2 family, promoting tumor metastasis, which is deduced from the evolutionary conservation of the membrane protein family containing multiple membrane spanning segments
17912957 Human keratinocytes were transfected with either Flip, Faim, or Lifeguard (LFG). Our results suggest that heterotopic expression of antiapoptotic proteins can induce the resistance of keratinocytes to a major mechanism of rejection.

AA Sequence

MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDP      1 - 70
SSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGW     71 - 140
YWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVT    141 - 210
VFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNR    211 - 280
RHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE                                      281 - 316
//

Text Mined References (35)

PMID Year Title
26398169 2015 TRIM21, a negative modulator of LFG in breast carcinoma MDA-MB-231 cells in vitro.
25922107 2015 Influence of lifestyle on the FAIM2 promoter methylation between obese and lean children: a cohort study.
25764978 2015 The transmembrane Bax inhibitor motif (TMBIM) containing protein family: Tissue expression, intracellular localization and effects on the ER CA²?-filling state.
25735388 2015 KRT13, FAIM2 and CYP2W1 mRNA expression in oral squamous cell carcinoma patients with risk habits.
25696115 2015 Promoter methylation of fas apoptotic inhibitory molecule 2 gene is associated with obesity and dyslipidaemia in Chinese children.
25069766 2014 Role of lifeguard ?-isoform in the development of breast cancer.
24621099 2014 Meta-analyses between 18 candidate genetic markers and overweight/obesity.
24393375 2014 Novel association of the obesity risk-allele near Fas Apoptotic Inhibitory Molecule 2 (FAIM2) gene with heart rate and study of its effects on myocardial infarction in diabetic participants of the PREDIMED trial.
24335530 2014 Modulation of hippocampal neuroplasticity by Fas/CD95 regulatory protein 2 (Faim2) in the course of bacterial meningitis.
23924573 2013 Common rs7138803 variant of FAIM2 and obesity in Han Chinese.
22889921 2013 Genome-wide association study of obsessive-compulsive disorder.
21957071 2011 Antiapoptotic protein Lifeguard is required for survival and maintenance of Purkinje and granular cells.
21935397 2011 Genome-wide population-based association study of extremely overweight young adults--the GOYA study.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20843981 2010 Associations of six single nucleotide polymorphisms in obesity-related genes with BMI and risk of obesity in Chinese children.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20336406 2010 The anti-apoptotic protein lifeguard is expressed in breast cancer cells and tissues.
20336373 2010 Transactivation of lifeguard (LFG) by Akt-/LEF-1 pathway in MCF-7 and MDA-MB 231 human breast cancer cells.
20215397 2010 Implication of genetic variants near NEGR1, SEC16B, TMEM18, ETV5/DGKG, GNPDA2, LIN7C/BDNF, MTCH2, BCDIN3D/FAIM2, SH2B1, FTO, MC4R, and KCTD15 with obesity and type 2 diabetes in 7705 Chinese.
19851340 2009 Association between obesity and polymorphisms in SEC16B, TMEM18, GNPDA2, BDNF, FAIM2 and MC4R in a Japanese population.
19812171 2010 Cumulative effects and predictive value of common obesity-susceptibility variants identified by genome-wide association studies.
19784873 2009 LFG: a candidate apoptosis regulatory gene family.
19557197 2009 NRXN3 is a novel locus for waist circumference: a genome-wide association study from the CHARGE Consortium.
19079260 2009 Genome-wide association yields new sequence variants at seven loci that associate with measures of obesity.
18440869 2008 Comparative genomics and function analysis on BI1 family.
17912957 2007 Inhibition of apoptosis by expression of antiapoptotic proteins in recombinant human keratinocytes.
17635665 2007 Lifeguard/neuronal membrane protein 35 regulates Fas ligand-mediated apoptosis in neurons via microdomain recruitment.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16964429 2006 Sequence analysis shows that Lifeguard belongs to a new evolutionarily conserved cytoprotective family.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10535980 1999 LFG: an anti-apoptotic gene that provides protection from Fas-mediated cell death.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.