Property Summary

NCBI Gene PubMed Count 15
PubMed Score 27.56
PubTator Score 21.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.700 3.0e-08
psoriasis 1.200 7.9e-04
posterior fossa group B ependymoma 1.700 1.4e-08
intraductal papillary-mucinous carcinoma... -1.100 1.2e-02
lung cancer 1.600 2.9e-03
pilocytic astrocytoma 1.100 3.4e-04
progressive supranuclear palsy -1.200 1.9e-02
ovarian cancer 2.000 1.0e-03

Gene RIF (7)

PMID Text
23138182 FAIM modulates IGF-1-induced Akt activation and IRF4 expression and has a role in multiple myeloma cell survival
20693673 FAIM (1-90) was crystallized and diffracted to a resolution of 2.5 A; the crystal belonged to space group P3(1), with unit-cell parameters a=b=58.02, c=71.11 A, alpha=beta=90, gamma=120 degrees.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19592656 FAIM acts to specifically enhance CD40 signaling for NF-kappaB activation, IRF-4 expression, and BCL-6 down-regulation in vitro, but has no effect on its own
17942717 Expression of the long form of Fas apoptotic inhibitory molecule (FAIML) results in the protection of neurons from the cytotoxic actions of death ligands.
17912957 Human keratinocytes were transfected with either Flip, Faim, or Lifeguard (LFG). Our results suggest that heterotopic expression of antiapoptotic proteins can induce the resistance of keratinocytes to a major mechanism of rejection.

AA Sequence

MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAI      1 - 70
SGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTET     71 - 140
HFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS                                   141 - 179
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23138182 2013 Fas apoptosis inhibitory molecule is upregulated by IGF-1 signaling and modulates Akt activation and IRF4 expression in multiple myeloma.
21269460 2011 Initial characterization of the human central proteome.
20693673 2010 Crystallization and preliminary X-ray crystallographic studies of human FAIM protein.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19592656 2009 Fas apoptosis inhibitory molecule enhances CD40 signaling in B cells and augments the plasma cell compartment.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17942717 2007 The long form of Fas apoptotic inhibitory molecule is expressed specifically in neurons and protects them against death receptor-triggered apoptosis.
17912957 2007 Inhibition of apoptosis by expression of antiapoptotic proteins in recombinant human keratinocytes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
10075978 1999 A novel gene coding for a Fas apoptosis inhibitory molecule (FAIM) isolated from inducibly Fas-resistant B lymphocytes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.