Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.14
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6P2I3 D3DXH7 Q8NDK1
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MLVSGRRRLLTALLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFL      1 - 70
EQGEATLSVARRALAAQLPVLPWSEVTFLAPVTWPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSI     71 - 140
VGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWLTRRNGKQWLLGKT    141 - 210
FDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSSNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTP    211 - 280
PGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV                                        281 - 314
//

Text Mined References (5)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.