Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.14
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 3.7e-02
pancreatic ductal adenocarcinoma liver m... -2.158 2.6e-03
intraductal papillary-mucinous neoplasm ... -1.100 1.7e-02
lung cancer 1.200 5.2e-04
group 4 medulloblastoma -1.100 3.8e-05
pilocytic astrocytoma -1.100 1.8e-06

Synonym

Accession Q96GK7 Q9Y3B0
Symbols CGI-105

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15551868 The X-ray structure of fumarylacetoacetate hydrolase family member FLJ36880 has been determined to 2.2 angstroms resolution employing the semi-automated high-throughput structural genomics approach.

AA Sequence

MLVSGRRRLLTVLLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFL      1 - 70
EQGEATLSVARRALAAQLPVLPRSEVTFLAPVTRPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSI     71 - 140
VGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWQMRRNGKQWLLGKT    141 - 210
FDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSGNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTP    211 - 280
PGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV                                        281 - 314
//

Text Mined References (11)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15551868 2004 X-ray structure of fumarylacetoacetate hydrolase family member Homo sapiens FLJ36880.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.