Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.21
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 3.7e-02
Astrocytoma, Pilocytic -1.100 1.6e-06
group 4 medulloblastoma -1.100 3.8e-05
intraductal papillary-mucinous neoplasm ... -1.100 1.7e-02
lung cancer 1.200 5.2e-04
pancreatic ductal adenocarcinoma liver m... -2.158 2.6e-03

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MLVSGRRRLLTVLLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFL      1 - 70
EQGEATLSVARRALAAQLPVLPRSEVTFLAPVTRPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSI     71 - 140
VGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWQMRRNGKQWLLGKT    141 - 210
FDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSGNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTP    211 - 280
PGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV                                        281 - 314
//

Text Mined References (11)

PMID Year Title