Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.28
PubTator Score 5.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.300 5.0e-03
atypical teratoid / rhabdoid tumor -1.200 4.2e-03
medulloblastoma -1.100 9.5e-03
medulloblastoma, large-cell -1.200 1.4e-04
ovarian cancer 1.500 1.3e-03
pancreatic ductal adenocarcinoma liver m... -1.033 1.4e-02

Gene RIF (6)

AA Sequence

MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHH      1 - 70
ELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVPKEKI     71 - 140
PDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIH    141 - 210
GLVSMTFKVEKPEY                                                            211 - 224
//

Text Mined References (21)

PMID Year Title