Property Summary

NCBI Gene PubMed Count 58
PubMed Score 51.28
PubTator Score 53.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 2.495 9.8e-06
medulloblastoma 1.500 1.2e-03
atypical teratoid / rhabdoid tumor 1.100 1.9e-02
glioblastoma 1.300 1.5e-02
medulloblastoma, large-cell 2.000 4.7e-04
ovarian cancer 1.800 2.0e-05

Synonym

Accession Q9UNN5 Q549F0 Q9UF34 Q9UNT3 Q9Y2Z3 hFAF1
Symbols hFAF1
CGI-03
HFAF1s
UBXD12
UBXN3A

Gene

PDB

1H8C   2DZM   2EC4   3E21   3QC8   3QCA   3QQ8   3QWZ   3QX1   3R3M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (36)

PMID Text
26842564 Progression of the DNA replication fork is coordinated by FAF1. FAF1 binds to the licensing factor CDT-1 and additional ubiquitylated proteins, thus promoting CDC48-dependent turnover and disassembly of DNA replication factor complexes.
26811330 FAF1 plays a novel role in negatively regulating virus-induced IFN-beta production and the antiviral response by inhibiting the translocation of active, phosphorylated IRF3 from the cytosol to the nucleus
24885147 The repertoire of VAPB interactors is more diverse than previously anticipated and link VAPB to the function of ATPase complexes such as p97/FAF1 and ASNA1/transmembrane-domain recognition complex.
24810049 Report a novel role for FAF1 in regulating CD40-induced NFkappaB activation via a negative feedback loop.
23720822 long-chain unsaturated fatty acids also induced polymerization of Fas-associated factor 1 (FAF1), the only other mammalian protein that contains a UAS domain homologous to that of Ubxd8
23293021 Data indicate that Npl4-Ufd1 heterodimer is required for VCP-FAF1 interaction.
22876279 hFAF1 inhibits tumor formation by increasing the degradation of Hsp70 mediated via its UBA domain.
22730322 Fas-associated factor 1 is a scaffold protein that promotes beta-transducin repeat-containing protein (beta-TrCP)-mediated beta-catenin ubiquitination and degradation.
22102026 Wild-type p97/VCP ND1 in complex with FAF1 UBX crystallized into very thin sheet-shaped crystals which turned out to be of poor diffraction quality
21978668 The authors report the first in vitro confirmed non-homotypic interaction between NLRP12 pyrin domain and the pro-apoptotic protein Fas-associated factor 1 (FAF-1), which links the innate immune system to apoptotic signaling.
21849551 In transgenic mice in which FAF1 is expressed in immature olfactory sensory neurons (OSNs), FAF1 not only misroutes OSN axons to deep layers of the olfactory bulb but also disrupts the glomerular layer
21645854 FAF1 and UBXD7 only bind to p97-UFD1/NPL4, but not free p97, thus demonstrating for the first time a hierarchy in p97-cofactor interactions
21414298 the crystal structure of human FAF1 UBX domain at 2.9A resolution is reported.
21295280 Mutations in FAF1 is associated with cleft palate and is necessary for lower jaw development in zebrafish.
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20195546 Data show that miR-24 regulates apoptosis by targeting FAF1 in cancer cells.
20124726 report FAF1 UBX domain crystallization and X-ray data collection. X-ray data were collected to 3.00 A resolution and the crystals belonged to space group F4(1)32, with unit-cell parameters a = b = c = 176.40 A.
20057067 the p97/VCP N domain was crystallized in complex with the FAF1 UBX domain. X-ray data were collected to 2.60 A resolution and the crystals belonged to space group C222(1), with unit-cell parameters a = 58.24, b = 72.81, c = 132.93 A.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19722279 Determined the crystal structure of the ubiquitin-associated domain of human FAF1 (hFAF1-UBA) and examined its interaction with ubiquitin and ubiquitin-like proteins using nuclear magnetic resonance.
19422935 Observational study of gene-disease association. (HuGE Navigator)
19174780 Observational study of gene-disease association. (HuGE Navigator)
18790738 analysis of the negative feedback regulation of Aurora-A via phosphorylation of Fas-associated factor-1
18573343 Changes in FAF1 expression were specific to PD-related alpha-synuclein pathology and nigral cell loss. These studies, together with previous genetic linkage studies, highlight the potential significance of FAF1 in pathogenesis of idiopathic PD.
17999750 Fas expression was reduced and caspase-10 activity was decreased in both patients
17684021 FAF1 robustly suppresses NF-kappaB activation through the inhibition of IKK activation in combination with previously reported cytoplasmic retention of NF-kappaB p65
17046979 FAF1 functions as a negative regulator of an NF-kappaB signal pathway that involves PYPAF1 and ASC.
15743842 hFAF1 may serve as a scaffolding protein that regulates protein degradation in the ubiquitin-proteasome pathway.
15596450 hFAF1 prevents cells from recovery after stress by binding to and inhibiting the chaperone activity of Hsp70
14600157 a novel function of FAF1: NF-kappaB activity suppressor by cytoplasmic retention of NF-kappaB p65 via physical interaction.
12963981 FAS-associated factor 1 is specifically reduced in human gastric carcinomas
12832043 phosphorylation by protein kinase CK2 influencing transport into nucleus
12702723 FAF1 is a member of Fas-DISC acting upstream of caspase-8

AA Sequence

MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETIPGPAFNPAS      1 - 70
HPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKM     71 - 140
LLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQREYNLN    141 - 210
FSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEE    211 - 280
QITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHP    281 - 350
VFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSN    351 - 420
RARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTAQ    421 - 490
QQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRLSLEQA    491 - 560
LPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPN    561 - 630
KSLLEVKLFPQETLFLEAKE                                                      631 - 650
//

Text Mined References (65)

PMID Year Title
26842564 2016 Chromatin-associated degradation is defined by UBXN-3/FAF1 to safeguard DNA replication fork progression.
26811330 2016 Fas-Associated Factor 1 Negatively Regulates the Antiviral Immune Response by Inhibiting Translocation of Interferon Regulatory Factor 3 to the Nucleus.
24885147 2014 VAPB/ALS8 interacts with FFAT-like proteins including the p97 cofactor FAF1 and the ASNA1 ATPase.
24810049 2014 Fas-associated factor (Faf1) is a novel CD40 interactor that regulates CD40-induced NF-?B activation via a negative feedback loop.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23720822 2013 UAS domain of Ubxd8 and FAF1 polymerizes upon interaction with long-chain unsaturated fatty acids.
23293021 2013 Complex of Fas-associated factor 1 (FAF1) with valosin-containing protein (VCP)-Npl4-Ufd1 and polyubiquitinated proteins promotes endoplasmic reticulum-associated degradation (ERAD).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22876279 2012 Ubiquitin-associated (UBA) domain in human Fas associated factor 1 inhibits tumor formation by promoting Hsp70 degradation.
22730322 2012 Fas-associated factor 1 is a scaffold protein that promotes ?-transducin repeat-containing protein (?-TrCP)-mediated ?-catenin ubiquitination and degradation.
22102026 2011 Crystallization and preliminary X-ray crystallographic analysis of the hexameric human p97/VCP ND1 fragment in complex with the UBX domain of human FAF1.
22064162 2012 Genome-wide association study of comorbid depressive syndrome and alcohol dependence.
21978668 2011 The NLRP12 pyrin domain: structure, dynamics, and functional insights.
21849551 2011 Fas-associated factor 1 as a regulator of olfactory axon guidance.
21645854 2011 Hierarchical binding of cofactors to the AAA ATPase p97.
21414298 2011 Crystal structure of human FAF1 UBX domain reveals a novel FcisP touch-turn motif in p97/VCP-binding region.
21295280 2011 FAF1, a gene that is disrupted in cleft palate and has conserved function in zebrafish.
21269460 2011 Initial characterization of the human central proteome.
21076409 2010 Common variants in 22 loci are associated with QRS duration and cardiac ventricular conduction.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20195546 2010 miR-24 regulates apoptosis by targeting the open reading frame (ORF) region of FAF1 in cancer cells.
20124726 2010 Crystallization and preliminary X-ray crystallographic analysis of human FAF1 UBX domain.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20057067 2010 Crystallization and preliminary X-ray crystallographic analysis of the N domain of p97/VCP in complex with the UBX domain of FAF1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19722279 2009 Structure and interaction of ubiquitin-associated domain of human Fas-associated factor 1.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19174780 2009 Confirmation of multiple Crohn's disease susceptibility loci in a large Dutch-Belgian cohort.
18790738 2008 Negative feedback regulation of Aurora-A via phosphorylation of Fas-associated factor-1.
18775313 2008 UBXD7 binds multiple ubiquitin ligases and implicates p97 in HIF1alpha turnover.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18573343 2008 Fas-associated factor 1 and Parkinson's disease.
17999750 2007 Co-inherited mutations of Fas and caspase-10 in development of the autoimmune lymphoproliferative syndrome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17684021 2007 FAF1 suppresses IkappaB kinase (IKK) activation by disrupting the IKK complex assembly.
17046979 2006 Fas-associated factor 1 is a negative regulator of PYRIN-containing Apaf-1-like protein 1.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15743842 2005 Human Fas-associated factor 1, interacting with ubiquitinated proteins and valosin-containing protein, is involved in the ubiquitin-proteasome pathway.
15688372 2005 Fas-associated factor-1 mediates chemotherapeutic-induced apoptosis via death effector filament formation.
15596450 2005 Human Fas-associated factor 1 interacts with heat shock protein 70 and negatively regulates chaperone activity.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15207703 2004 Bmx is a downstream Rap1 effector in VEGF-induced endothelial cell activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14600157 2004 Fas-associated factor-1 inhibits nuclear factor-kappaB (NF-kappaB) activity by interfering with nuclear translocation of the RelA (p65) subunit of NF-kappaB.
12963981 2003 The pro-apoptotic FAS-associated factor 1 is specifically reduced in human gastric carcinomas.
12832043 2003 Protein kinase CK2 phosphorylates the Fas-associated factor FAF1 in vivo and influences its transport into the nucleus.
12702723 2003 Fas-associated factor 1, FAF1, is a member of Fas death-inducing signaling complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12372427 2002 Cloning and characterization of the highly expressed ETEA gene from blood cells of atopic dermatitis patients.
12087183 2002 Functional analysis of the transcription factor ER71 and its activation of the matrix metalloproteinase-1 promoter.
11713579 2001 FAS-associated factor 1 interacts with protein kinase CK2 in vivo upon apoptosis induction.
11527403 2001 Apoptosis induced by human Fas-associated factor 1, hFAF1, requires its ubiquitin homologous domain, but not the Fas-binding domain.
11378439 2001 Phosphorylation of the Fas associated factor FAF1 by protein kinase CK2 and identification of serines 289 and 291 as the in vitro phosphorylation sites.
11243799 2001 The UBX domain: a widespread ubiquitin-like module.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
10462485 1999 Identification and characterization of human Fas associated factor 1, hFAF1.
10094392 1999 Interactions of protein kinase CK2beta subunit within the holoenzyme and with other proteins.
9740801 1998 Essential requirement for caspase-8/FLICE in the initiation of the Fas-induced apoptotic cascade.
8524870 1995 A Fas-associated protein factor, FAF1, potentiates Fas-mediated apoptosis.