Property Summary

NCBI Gene PubMed Count 31
PubMed Score 14.72
PubTator Score 70.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
group 3 medulloblastoma -2.400 2.7e-06
non diabetic and post-ischemic heart fai... -1.100 3.3e-03
atypical teratoid / rhabdoid tumor -1.200 1.6e-04
medulloblastoma, large-cell -1.900 5.3e-06
acute quadriplegic myopathy 1.692 1.8e-08
tuberculosis -1.300 1.1e-06
non-small cell lung cancer -1.144 2.7e-10
Hydrolethalus syndrome 1.074 4.8e-02
spina bifida 1.039 3.7e-02
Alzheimer's disease -1.100 1.9e-02
Pick disease -1.600 9.2e-06
ductal carcinoma in situ -2.000 3.5e-04
invasive ductal carcinoma -1.800 7.3e-03

Gene RIF (15)

PMID Text
24985009 Minor allele homozygotes and heterozygotes of rs174455 in FADS3 gene had lower levels of 22:5 omega-3, 20:4 omega-6, and Delta5desaturase activity in patients with type 2 diabetes mellitus.
22877655 genetic association study in maternal/child dyads in England: Data suggest that SNPs in FADS3 (and in FADS1/FADS2) influence fetal fatty acid metabolism; both maternal and child FADS genotypes/haplotypes influence cord plasma long-chain fatty acids.
22398025 Data suggest that FADS3 alternative transcripts/splicing are up-regulated in liver by dietary docosahexaenoic/arachidonic acids by peroxisome proliferator-activated receptor gamma (PPARg)-dependent mechanism unrelated to other desaturases (FADS1/2).
22082156 Knockdown of fatty acid desaturase 3 (FADS3) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21366865 it is highly likely that a gene product of FADS3 has desaturating activity.
21040914 Observational study of gene-disease association. (HuGE Navigator)
20972250 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20562440 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19752397 FADS3 does exist under multiple protein isoforms depending on the mammalian tissues.
19750004 USF1 and FADS3 are causal candidate genes for the Mexican familial combined hyperlipidemia.
19148276 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19060911 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19060906 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MGGVGEPGPREGPAQPGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDA      1 - 70
TDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVEDFRALHQAAEDMKLFDASPTFFAFLLG     71 - 140
HILAMEVLAWLLIYLLGPGWVPSALAAFILAISQAQSWCLQHDLGHASIFKKSWWNHVAQKFVMGQLKGF    141 - 210
SAHWWNFRHFQHHAKPNIFHKDPDVTVAPVFLLGESSVEYGKKKRRYLPYNQQHLYFFLIGPPLLTLVNF    211 - 280
EVENLAYMLVCMQWADLLWAASFYARFFLSYLPFYGVPGVLLFFVAVRVLESHWFVWITQMNHIPKEIGH    281 - 350
EKHRDWVSSQLAATCNVEPSLFTNWFSGHLNFQIEHHLFPRMPRHNYSRVAPLVKSLCAKHGLSYEVKPF    351 - 420
LTALVDIVRSLKKSGDIWLDAYLHQ                                                 421 - 445
//

Text Mined References (33)

PMID Year Title
25194280 2014 Genome-wide association study identifies three susceptibility loci for laryngeal squamous cell carcinoma in the Chinese population.
24985009 Genetic variants in desaturase gene, erythrocyte fatty acids, and risk for type 2 diabetes in Chinese Hans.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23378610 2013 Genetic variants associated with glycine metabolism and their role in insulin sensitivity and type 2 diabetes.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22877655 2013 Umbilical cord PUFA are determined by maternal and child fatty acid desaturase (FADS) genetic variants in the Avon Longitudinal Study of Parents and Children (ALSPAC).
22398025 2013 Dietary long-chain polyunsaturated fatty acids upregulate expression of FADS3 transcripts.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
21366865 2011 Genetic variation in polyunsaturated fatty acid metabolism and its potential relevance for human development and health.
21040914 2011 FADS gene polymorphisms in Koreans: association with ?6 polyunsaturated fatty acids in serum phospholipids, lipid peroxides, and coronary artery disease.
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20562440 2010 FADS genetic variants and omega-6 polyunsaturated fatty acid metabolism in a homogeneous island population.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19798445 2009 Genetic determinants of circulating sphingolipid concentrations in European populations.
19752397 2010 The fatty acid desaturase 3 gene encodes for different FADS3 protein isoforms in mammalian tissues.
19750004 2009 A systems genetics approach implicates USF1, FADS3, and other causal candidate genes for familial combined hyperlipidemia.
19148276 2009 Genome-wide association study of plasma polyunsaturated fatty acids in the InCHIANTI Study.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10860662 2000 cDNA cloning, genomic structure, and chromosomal localization of three members of the human fatty acid desaturase family.