Property Summary

NCBI Gene PubMed Count 141
PubMed Score 416.69
PubTator Score 168.23

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (113)

PMID Text
27004414 Single nucleotide polymorphisms in FADS gene (particularly rs174537) associate with plasma fatty acids and desaturase levels in patients with both type 2 diabetes and coronary artery disease.
26633493 polymorphisms in the FADS gene cluster were nominally associated with reduced risk of developing atopic eczema
26513616 No associations were observed between any single-nucleotide polymorphisms and major depressive disorder diagnosis or attempted suicide status.
26501394 FADS1 variants modulate the relationship between marine fatty acid intake and circulating levels of long-chain omega-3 fatty acids.
26474818 genetic association study in population of pregnant women in Republic of Seychelles: SNPs in FADS1/FADS2 are associated with maternal arachidonic acid status; a subtle association exists with neurodevelopment in this high fish-eating population. [REVIEW]
26283408 genome-wide association study in population of mother/infant dyads in Denmark: Data suggest SNPs in maternal FADS1 are associated with (1) lower breast milk polyunsaturated fatty acid and (2) higher production of interleukins by infant T-lymphocytes.
26261632 Suggest that the FADS1 rs174546 SNP and the FADS2 rs174601 SNP are associated with the risk of coronary artery disease and ischemic stroke, and are likely to influence serum lipid levels.
26163647 Decreased Expression of FADS1 is associated with Esophageal Squamous Cell Carcinoma.
25981324 In northern Han Chinese people, the minor allele (T) of rs174616 in the FADS1-FADS2 gene cluster is associated with a decreased conversion rate of Linoleic acid to Arachidonic acid, which may contribute to decreased reduced risk of developing T2 diabetes.
25849351 High dietary n-3 LCPUFA intakes could negate the unfavorable effect of genetic variation in FADS1 on CAD in middle-aged and elderly Chinese population.
25828602 Data suggest that down-regulation of FADS1 (delta-5 fatty acid desaturase) and up-regulation of FADS2 (delta-6 fatty acid desaturase) in obesity leads to altered long-chain polyunsaturated fatty acid nutritional status. [META-ANALYSIS, REVIEW]
25755223 Fads1 and Fads2 gene expression was reduced by EPA and AA, but not ALA or LA
25626431 Dietary fatty acids modulate associations between FADS1 genetic variants and circulating fatty acids in plasma and erythrocyte membranes.
25500337 Study shows that docosahexaenoic acid (DHA) and arachidonic acid (ARA) levels were lower in pregnant women homozygous for FADS1 rs174533 but after DHA supplementation, ARA level decreases in women homozygous for both FADS1rs174533 and FADS2rs1747575.
25123259 rare alleles of SNPs significantly associated with the accumulation of multiple long-chain fatty acids in the liver
25080457 genetic association study in population of children in Denmark: Data suggest that SNPs in FADS1 (rs1535, rs174448, rs174575) are associated with developmental psychomotor disorders at 30 months of age.
25038994 Recent genome-wide association studies showed that FADS1/FADS2 genetic locus, beyond being the main determinant of PUFA, was strongly associated with plasma lipids and glucose metabolism.
25008580 we found weak, but not convincing, evidence of effect modification by genetic variation in FADS1 on the associations between polyunsaturated fatty acid intakes and cardiovascular disease risk.
24991040 maternal rs174556 FADS SNP modified the associations of maternal docosahexaenoic acid (DHA) intake in pregnancy with pregnancy duration and child birth weight
24985009 Minor allele homozygotes and heterozygotes of rs174575 and rs174537 had lower PL 20:4 omega-6 levels in healthy individuals.
24962583 examined the impact of a highly influential FADS SNP, rs174537 on leukotriene, HETE, prostaglandin, and thromboxane biosynthesis in stimulated whole blood
24936800 These results suggest that genetic variation at the FADS locus can influence an individual's response to fish oil supplements.
24240437 ALA intake was significantly more protective for IA in the presence of an increasing number of minor alleles at FADS1
24167612 Changes in the mRNA-expression levels of FADS1 and 2 directly affect blood DGLA levels and D6D activity. This study suggests that lower mRNA-expressions of FADS2 and ELOVL5 are associated with higher risk of atopic eczema in young children.
24022589 Single-nucleotide polymorphisms in the FADS1 gene is associated with lower arachidonic acid concentrations in the colon.
23867726 Weak evidence suggests that SNPs in FADS1/2 may influence high sensitivity C-reactive protein levels in young adults.
23818766 FADS snps can affect age-associated changes in serum PUFAs, Delta5-desaturase and oxidative stress in middle-aged nonobese men. The rs174537T allele did not show increases in AA and Delta5-desaturase activity seen with the rs174537GG genotype.
23721366 We conclude that FADS2 genotype may play a role in peroxidation susceptibility of lipoproteins
23555103 These findings suggest that the polymorphisms of rs174556 in the FADS1 gene are very likely to be associated with acute coronary syndrome in Chinese Han population, especially in subjects with hypertension
23396965 These data suggested that FADS1 genetic variant was associated with circulating PUFA and lipid levels and that its effect on HDL cholesterol might depend on PUFA status in the Han Chinese population.
23221573 In minor allele homozygotes, increased alpha-linolenic acid intake resulted in increased plasma eicosapentaenoic acid composition.
23211517 Data suggest that mRNA expression of delta-5 and delta-6 desaturases are down-regulated 40-50% in vitamin B-6-restricted hepatocytes.
23160180 study concludes different sites at the FADS1-FADS2 locus appear to influence Delta-5 and Delta-6 desaturase (D5D and D6D) activity, and rs174537 genotype interacts with dietary eicosapentaenoic acid and docosahexaenoic acid to modulate D5D
22992776 Single Nucleotide Polymorphism in FADS1 gene is associated with type 2 diabetes.
22960237 Findings suggest that the 3 genes, FADS1, FADS2, and DCHS2, containing these SNPs might play dual roles influencing both CSI and ALM in males.
22911844 The aim of this study was to investigate the relation between these ratios as well as genotypes of FADS1 rs174547 and coronary heart disease incidence.
22900039 the minor haplotype variant of the FADS1 gene was associated with an increase in dihomo-gamma linolenic acid (DGLA) level in human brain tissue.
22877655 genetic association study in maternal/child dyads in England: Data suggest that SNPs in FADS1 (and in FADS2/FADS3) influence fetal fatty acid metabolism; both maternal and child FADS genotypes/haplotypes influence cord plasma long-chain fatty acids.
22748975 A single nucleotide polymorphism and a haplotype in intron 1 of FADS2 were significantly associated with FADS1 expression.
22629455 Total cholesterol, HDL, LDL and triglyceride concentrations may be influenced by the FADS1 FADS2 genotype already in 10 year old children.
22619218 discovery and function of a novel FADS1 splice variant
22490578 rs174547 in FADS1 may contribute to the susceptibility of CHD by altering HDL-C and TG levels in Chinese individuals.
22153152 Report relationship of serum fatty acid composition and desaturase activity to C-reactive protein in Japanese men and women.
21917437 rs174556 in the FADS1 gene is very likely to be associated with coronary artery disease in the Chinese Han population
21818279 Correlation coefficients were estimated to describe fatty acid tracking over 4 years and to assess the influence of FADS variants on tracking.
21793953 The association between dietary intake of fatty acids and allergic diseases might be modulated by FADS gene variants in children.
21733300 genetic association studies in African Americans and European Americans: Seven SNP in FADS gene cluster are associated with plasma omega-6/omega-3 fatty acids; data suggest ethnic differences in synthesis of long-chain polyunsaturated fatty acids.
21613373 These results confirm associations of age-related macular degeneration with variants near the TIMP3 gene and at loci involved in HDL metabolism
21605700 increased expression of fatty acid Delta5- and Delta6-desaturases in cystic fibrosis correlated with selective abnormalities in essential fatty acid concentrations
21599946 impact of FADS genetic variants on PUFA metabolism, specifically AA levels, is likely more pronounced in African Americans due to larger proportion of individuals carrying the genotype associated with increased FADS1 enzymatic conversion of DGLA to AA
21593353 assessed whether dietary linoleic acid or alpha-linolenic acid modulate the association between the FADS1 rs174546 polymorphism and concentrations of PUFA, other lipids, and lipoproteins in adolescents
21560298 rs174556 in FADS1 gene and rs174617 in FADS2 gene may not be associated with paranoid schizophrenia.
21414826 This study shows that genetic variation in the FADS gene cluster (in particular rs174547) can alter desaturase activity in subjects of Caucasians and Asian descent.
21383846 Not being breastfed conferred an 8- to 9-point disadvantage in cognition among children GG homozygote for rs174468 (low FADS1 activity) but not among those with the A allele.
21106917 Genetic variants of the fatty acid desaturase gene cluster predict amounts of red blood cell docosahexaenoic and other polyunsaturated fatty acids in pregnant women.
21040914 The rs174537T polymorphism of FADS1 is associated with a lower proportion of arachidonic acid in serum phospholipids and reduced coronary artery disease risk, in association with reduced total- and LDL-cholesterol and lipid peroxides in Koreans
21040914 Observational study of gene-disease association. (HuGE Navigator)
20980488 stearoyl coenzyme A desaturase (SCD) and D6D activity, were directly related to diabetes risk in multivariable-adjusted models.
20980488 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20972250 Observational study of gene-disease association. (HuGE Navigator)
20948998 PUFA-composition in young children's blood is under strong control of the FADS-gene-cluster
20948998 Observational study of gene-disease association. (HuGE Navigator)
20716318 Observational study of gene-disease association. (HuGE Navigator)
20714348 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20691134 Genetic variation in the FADS1 FADS2 gene cluster affects n-6 polyunsaturated fatty acid profiles in erythrocytes reflecting altered delta-5-desaturase activity.
20691134 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20639392 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20565855 potential role in disease onset and development (Review)
20562440 Observational study of gene-disease association. (HuGE Navigator)
20484448 Genetic variation in the FADS1 gene potentially interacts with dietary polyunsaurated faatty acid intakes which in turn affects plasma cholesterol concentrations.
20484448 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20427696 association between genetic variability in the FADS gene cluster and delt-5 and delta-6 desaturase activities
20427696 Observational study of gene-disease association. (HuGE Navigator)
20419449 Observational study of gene-disease association. (HuGE Navigator)
20395685 Observational study of gene-disease association. (HuGE Navigator)
20385826 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20364269 A single nucleotide polymorphism in the FADS1/FADS2 gene is associated with plasma lipid profiles in two genetically similar Asian ethnic groups with distinctive differences in life style.
20364269 Observational study of gene-disease association. (HuGE Navigator)
20335541 Lower proportions of docosahexenoic acid in milk from women homozygous for a minor allele in t4his gene could not be compensated for by increasing fish and fish-oil intake.
20335541 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20185807 Observational study of gene-disease association. (HuGE Navigator)
20081858 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20060505 Immunofluorescence confocal microscopy performed on BHK-21 and Caco-2 cell lines transiently expressing the two human isoforms, definitively confirmed that hFADS1, but not hFADS2, localizes in mitochondria.
20045144 Strong associations between variants in the human genes FADS1, and blood levels of polyunsaturated fatty acids have been reported--REVIEW
20045144 Observational study of gene-disease association. (HuGE Navigator)
20037589 Observational study of gene-disease association. (HuGE Navigator)
19948371 impact of FADS1 genotype on LC-PUFA/lipid metabolism and influence on intellectual development in infants and chronic metabolic diseases [REVIEW]
19913121 Observational study of gene-disease association. (HuGE Navigator)
19875987 Liver Delta-6D and Delta-5D activities in obese patients were 87% and 66% lower than controls (P < 0.001)
19809313 Observational study of gene-disease association. (HuGE Navigator)
19776639 Single nucleotide polymorphisms (SNPs) in the 2 desaturase encoding gene FADS1 is highly associated with the concentration of omega-6 and omega-3 fatty acids.
19750004 Observational study of gene-disease association. (HuGE Navigator)
19148276 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19060910 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19060906 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18936223 This study showed that genetic variants of FADS1 and FADS2 influence blood lipid and breast milk essential fatty acids in pregnancy and lactation.
18936223 Observational study of gene-disease association. (HuGE Navigator)
18842780 In populations following a Western diet, subjects carrying FADS haplotypes that are associated with higher desaturase activity may be prone to a proinflammatory response favoring atherosclerotic vascular damage.
18842780 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18626191 Observational study of gene-disease association. (HuGE Navigator)
18479586 Observational study of gene-disease association. (HuGE Navigator)
18320251 strong association of FADS1 gene polymorphisms with the levels of arachidonic acid, which is a precursor of molecules involved in inflammation and immunity processes, cardiovascular disease.
18320251 Observational study of gene-disease association. (HuGE Navigator)
17852835 The results indicate that when the supply of FA to HL60 cells is limited, the intracellular content of n-3 and n-6 FA decreases and this leads to upregulation of the desaturases, particularly D5D and D6D.
17655842 SREBP-1 is involved in the early regulation of delta5 desaturase gene by simvastatin, in THP-1 cells.
16893529 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16846730 support a significant role for reverse Delta5-desaturase as a natural antisense regulator of Delta5-desaturase
16670158 Observational study of gene-disease association. (HuGE Navigator)
16670158 FADS1 FADS2 genetic varients and their reconstructed haplotypes are associated with the fatty acid composition in phospholipids
16643857 This is the first report on characterization of human FADS, and the first cloning and over-expression of FADS from an organism higher than yeast.

AA Sequence

MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDP      1 - 70
FVAFHINKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVERMGLMKANHVFFLLYLLHIL     71 - 140
LLDGAAWLTLWVFGTSFLPFLLCAVLLSAVQAQAGWLQHDFGHLSVFSTSKWNHLLHHFVIGHLKGAPAS    141 - 210
WWNHMHFQHHAKPNCFRKDPDINMHPFFFALGKILSVELGKQKKKYMPYNHQHKYFFLIGPPALLPLYFQ    211 - 280
WYIFYFVIQRKKWVDLAWMITFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHD    281 - 350
RNMDWVSTQLQATCNVHKSAFNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL    351 - 420
SAFADIIHSLKESGQLWLDAYLHQ                                                  421 - 444
//

Text Mined References (145)

PMID Year Title
27004414 2016 Polymorphisms in FADS1 and FADS2 alter plasma fatty acids and desaturase levels in type 2 diabetic patients with coronary artery disease.
26633493 2015 Single Nucleotide Polymorphisms in the FADS Gene Cluster but not the ELOVL2 Gene are Associated with Serum Polyunsaturated Fatty Acid Composition and Development of Allergy (in a Swedish Birth Cohort).
26513616 2016 Lack of association of SNPs from the FADS1-FADS2 gene cluster with major depression or suicidal behavior.
26501394 2016 Gene-diet interaction of a common FADS1 variant with marine polyunsaturated fatty acids for fatty acid composition in plasma and erythrocytes among men.
26474818 2015 Genetic variation in FADS genes is associated with maternal long-chain PUFA status but not with cognitive development of infants in a high fish-eating observational study.
26283408 2015 Maternal fatty acid desaturase genotype correlates with infant immune responses at 6 months.
26261632 2015 Association of two polymorphisms in the FADS1/FADS2 gene cluster and the risk of coronary artery disease and ischemic stroke.
26163647 2015 Decreased Expression of FADS1 Predicts a Poor Prognosis in Patients with Esophageal Squamous Cell Carcinoma.
25981324 2015 Polymorphisms of rs174616 in the FADS1-FADS2 gene cluster is associated with a reduced risk of type 2 diabetes mellitus in northern Han Chinese people.
25849351 2015 Dietary n-3 polyunsaturated fatty acid intakes modify the effect of genetic variation in fatty acid desaturase 1 on coronary artery disease.
25828602 2015 Long-chain polyunsaturated fatty acid status in obesity: a systematic review and meta-analysis.
25755223 2015 Polyunsaturated fatty acid regulation of adipocyte FADS1 and FADS2 expression and function.
25626431 2015 Dietary fatty acids modulate associations between genetic variants and circulating fatty acids in plasma and erythrocyte membranes: Meta-analysis of nine studies in the CHARGE consortium.
25500337 2015 Docosahexaenoic acid (DHA) supplementation in pregnancy differentially modulates arachidonic acid and DHA status across FADS genotypes in pregnancy.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25194280 2014 Genome-wide association study identifies three susceptibility loci for laryngeal squamous cell carcinoma in the Chinese population.
25187374 2015 Genome-wide association meta-analysis identifies novel variants associated with fasting plasma glucose in East Asians.
25123259 2015 Fatty acid desaturase 1 gene polymorphisms control human hepatic lipid composition.
25080457 2014 FADS single-nucleotide polymorphisms are associated with behavioral outcomes in children, and the effect varies between sexes and is dependent on PPAR genotype.
25038994 2014 Delta-5 and delta-6 desaturases: crucial enzymes in polyunsaturated fatty acid-related pathways with pleiotropic influences in health and disease.
25008580 2014 Genetic variation in FADS1 has little effect on the association between dietary PUFA intake and cardiovascular disease.
24991040 2014 Maternal but not fetal FADS gene variants modify the association between maternal long-chain PUFA intake in pregnancy and birth weight.
24985009 Genetic variants in desaturase gene, erythrocyte fatty acids, and risk for type 2 diabetes in Chinese Hans.
24962583 2014 Relationship between a common variant in the fatty acid desaturase (FADS) cluster and eicosanoid generation in humans.
24936800 2014 The role of FADS1/2 polymorphisms on cardiometabolic markers and fatty acid profiles in young adults consuming fish oil supplements.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24240437 2014 Erythrocyte membrane docosapentaenoic acid levels are associated with islet autoimmunity: the Diabetes Autoimmunity Study in the Young.
24167612 2013 Gene expression of desaturase (FADS1 and FADS2) and Elongase (ELOVL5) enzymes in peripheral blood: association with polyunsaturated fatty acid levels and atopic eczema in 4-year-old children.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24022589 2013 Interaction of fatty acid genotype and diet on changes in colonic fatty acids in a Mediterranean diet intervention study.
23867726 2013 Variation in the FADS1/2 gene cluster alters plasma n-6 PUFA and is weakly associated with hsCRP levels in healthy young adults.
23818766 2013 Association of polymorphisms in FADS gene with age-related changes in serum phospholipid polyunsaturated fatty acids and oxidative stress markers in middle-aged nonobese men.
23721366 2013 Delta-6-desaturase gene polymorphism is associated with lipoprotein oxidation in vitro.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
23555103 2013 A case-control study between gene polymorphisms of polyunsaturated fatty acid metabolic rate-limiting enzymes and acute coronary syndrome in Chinese Han population.
23396965 2013 Interaction between a common variant in FADS1 and erythrocyte polyunsaturated fatty acids on lipid profile in Chinese Hans.
23378610 2013 Genetic variants associated with glycine metabolism and their role in insulin sensitivity and type 2 diabetes.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23303382 2013 Genome-wide association study of serum albumin:globulin ratio in Korean populations.
23281178 2013 A genome-wide assessment of variability in human serum metabolism.
23221573 2013 Dietary oils and FADS1-FADS2 genetic variants modulate [13C]?-linolenic acid metabolism and plasma fatty acid composition.
23211517 2013 Vitamin B-6 restriction impairs fatty acid synthesis in cultured human hepatoma (HepG2) cells.
23160180 2013 Genetic variation at the FADS1-FADS2 gene locus influences delta-5 desaturase activity and LC-PUFA proportions after fish oil supplement.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22992776 2012 Variations with modest effects have an important role in the genetic background of type 2 diabetes and diabetes-related traits.
22960237 2012 Bivariate genome-wide association study suggests fatty acid desaturase genes and cadherin DCHS2 for variation of both compressive strength index and appendicular lean mass in males.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22911844 2012 Markers of endogenous desaturase activity and risk of coronary heart disease in the CAREMA cohort study.
22900039 2012 Age and haplotype variations within FADS1 interact and associate with alterations in fatty acid composition in human male cortical brain tissue.
22877655 2013 Umbilical cord PUFA are determined by maternal and child fatty acid desaturase (FADS) genetic variants in the Avon Longitudinal Study of Parents and Children (ALSPAC).
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22748975 2012 Insertion-deletions in a FADS2 intron 1 conserved regulatory locus control expression of fatty acid desaturases 1 and 2 and modulate response to simvastatin.
22629455 2012 FADS1 FADS2 gene cluster, PUFA intake and blood lipids in children: results from the GINIplus and LISAplus studies.
22619218 2012 A novel FADS1 isoform potentiates FADS2-mediated production of eicosanoid precursor fatty acids.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22490578 2012 Fatty acid desaturase 1 polymorphisms are associated with coronary heart disease in a Chinese population.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
22153152 2012 Relationship of serum fatty acid composition and desaturase activity to C-reactive protein in Japanese men and women.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21917437 2011 A case-control study between the gene polymorphisms of polyunsaturated fatty acids metabolic rate-limiting enzymes and coronary artery disease in a Chinese Han population.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
21818279 2011 Influence of FADS polymorphisms on tracking of serum glycerophospholipid fatty acid concentrations and percentage composition in children.
21793953 2011 FADS gene variants modulate the effect of dietary fatty acid intake on allergic diseases in children.
21733300 2012 Differences in arachidonic acid levels and fatty acid desaturase (FADS) gene variants in African Americans and European Americans with diabetes or the metabolic syndrome.
21613373 2011 Evaluation of serum lipid concentrations and genetic variants at high-density lipoprotein metabolism loci and TIMP3 in age-related macular degeneration.
21605700 Increased ?5- and ?6-desaturase, cyclooxygenase-2, and lipoxygenase-5 expression and activity are associated with fatty acid and eicosanoid changes in cystic fibrosis.
21599946 2011 The impact of FADS genetic variants on ?6 polyunsaturated fatty acid metabolism in African Americans.
21593353 2011 FADS1 genetic variability interacts with dietary ?-linolenic acid intake to affect serum non-HDL-cholesterol concentrations in European adolescents.
21560298 2011 [A case-control study between gene polymorphisms of polyunsaturated fatty acids metabolic rate-limiting enzymes and paranoid schizophrenia of Han ethnicity in Jilin Province].
21414826 2011 Polymorphisms in FADS1 and FADS2 alter desaturase activity in young Caucasian and Asian adults.
21383846 2011 Genetic variants of the FADS gene cluster and ELOVL gene family, colostrums LC-PUFA levels, breastfeeding, and child cognition.
21106917 2011 Genetic variants of the fatty acid desaturase gene cluster predict amounts of red blood cell docosahexaenoic and other polyunsaturated fatty acids in pregnant women: findings from the Avon Longitudinal Study of Parents and Children.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21040914 2011 FADS gene polymorphisms in Koreans: association with ?6 polyunsaturated fatty acids in serum phospholipids, lipid peroxides, and coronary artery disease.
20980488 2011 Erythrocyte membrane phospholipid fatty acids, desaturase activity, and dietary fatty acids in relation to risk of type 2 diabetes in the European Prospective Investigation into Cancer and Nutrition (EPIC)-Potsdam Study.
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20948998 2010 Variants of the FADS1 FADS2 gene cluster, blood levels of polyunsaturated fatty acids and eczema in children within the first 2 years of life.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20716318 2010 No association between FADS polymorphisms and atopic diseases in children from the GINI and LISA birth cohorts.
20714348 2010 Common inherited variation in mitochondrial genes is not enriched for associations with type 2 diabetes or related glycemic traits.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
20691134 2010 Genetic variation of the FADS1 FADS2 gene cluster and n-6 PUFA composition in erythrocyte membranes in the European Prospective Investigation into Cancer and Nutrition-Potsdam study.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20639392 2010 Genome-wide association analysis identifies multiple loci related to resting heart rate.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20565855 2010 Genetic variation in lipid desaturases and its impact on the development of human disease.
20562440 2010 FADS genetic variants and omega-6 polyunsaturated fatty acid metabolism in a homogeneous island population.
20484448 2010 Dietary n-3 and n-6 polyunsaturated fatty acid intake interacts with FADS1 genetic variation to affect total and HDL-cholesterol concentrations in the Doetinchem Cohort Study.
20427696 2010 Single nucleotide polymorphisms in the FADS gene cluster are associated with delta-5 and delta-6 desaturase activities estimated by serum fatty acid ratios.
20419449 2010 Variants at DGKB/TMEM195, ADRA2A, GLIS3 and C2CD4B loci are associated with reduced glucose-stimulated beta cell function in middle-aged Danish people.
20395685 2009 Association of fatty acid desaturase gene polymorphisms with blood lipid essential fatty acids and perinatal depression among Canadian women: a pilot study.
20385826 2010 Genome-wide association study of advanced age-related macular degeneration identifies a role of the hepatic lipase gene (LIPC).
20364269 2010 A single nucleotide polymorphism in the FADS1/FADS2 gene is associated with plasma lipid profiles in two genetically similar Asian ethnic groups with distinctive differences in lifestyle.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20335541 2010 FADS1 FADS2 gene variants modify the association between fish intake and the docosahexaenoic acid proportions in human milk.
20185807 2010 Detailed physiologic characterization reveals diverse mechanisms for novel genetic Loci regulating glucose and insulin metabolism in humans.
20081858 2010 New genetic loci implicated in fasting glucose homeostasis and their impact on type 2 diabetes risk.
20060505 2010 Mitochondrial localization of human FAD synthetase isoform 1.
20045144 2010 Role of FADS1 and FADS2 polymorphisms in polyunsaturated fatty acid metabolism.
20037589 2010 A genome-wide perspective of genetic variation in human metabolism.
19948371 2010 Do FADS genotypes enhance our knowledge about fatty acid related phenotypes?
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19875987 2010 Decreased liver fatty acid delta-6 and delta-5 desaturase activity in obese patients.
19809313 2010 Genetic variants of the FADS1 FADS2 gene cluster as related to essential fatty acid metabolism.
19776639 2009 FADS gene cluster polymorphisms: important modulators of fatty acid levels and their impact on atopic diseases.
19750004 2009 A systems genetics approach implicates USF1, FADS3, and other causal candidate genes for familial combined hyperlipidemia.
19148276 2009 Genome-wide association study of plasma polyunsaturated fatty acids in the InCHIANTI Study.
19060910 2009 Genome-wide association analysis of metabolic traits in a birth cohort from a founder population.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19043545 2008 Genetics meets metabolomics: a genome-wide association study of metabolite profiles in human serum.
18936223 2008 Genetic variants of the FADS1 FADS2 gene cluster are associated with altered (n-6) and (n-3) essential fatty acids in plasma and erythrocyte phospholipids in women during pregnancy and in breast milk during lactation.
18842780 2008 FADS genotypes and desaturase activity estimated by the ratio of arachidonic acid to linoleic acid are associated with inflammation and coronary artery disease.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18626191 2008 Genetically determined variation in polyunsaturated fatty acid metabolism may result in different dietary requirements.
18479586 2009 Evidence for an association between genetic variants of the fatty acid desaturase 1 fatty acid desaturase 2 ( FADS1 FADS2) gene cluster and the fatty acid composition of erythrocyte membranes.
18320251 2008 SNPs of the FADS gene cluster are associated with polyunsaturated fatty acids in a cohort of patients with cardiovascular disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17852835 2007 Regulation of desaturase expression in HL60 cells.
17655842 2007 Delta5 desaturase mRNA levels are increased by simvastatin via SREBP-1 at early stages, not via PPARalpha, in THP-1 cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16893529 2006 Association of fatty acid desaturase genes with attention-deficit/hyperactivity disorder.
16846730 2006 A newly discovered member of the fatty acid desaturase gene family: a non-coding, antisense RNA gene to delta5-desaturase.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16670158 2006 Common genetic variants of the FADS1 FADS2 gene cluster and their reconstructed haplotypes are associated with the fatty acid composition in phospholipids.
16643857 2006 Over-expression in Escherichia coli and characterization of two recombinant isoforms of human FAD synthetase.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10860662 2000 cDNA cloning, genomic structure, and chromosomal localization of three members of the human fatty acid desaturase family.
10769175 2000 cDNA cloning and characterization of human Delta5-desaturase involved in the biosynthesis of arachidonic acid.
10601301 1999 Cloning, expression, and fatty acid regulation of the human delta-5 desaturase.
9445487 1998 A gene map of the Best's vitelliform macular dystrophy region in chromosome 11q12-q13.1.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.