Property Summary

NCBI Gene PubMed Count 56
PubMed Score 144.99
PubTator Score 95.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.100 1.4e-02
psoriasis -2.600 3.5e-15
cutaneous lupus erythematosus -3.500 2.6e-03
glioblastoma 1.800 1.5e-03
atypical teratoid/rhabdoid tumor 1.200 1.3e-03
medulloblastoma, large-cell -4.600 9.6e-06
Atopic dermatitis -2.700 2.3e-03
pediatric high grade glioma 1.700 2.9e-02
group 3 medulloblastoma -2.000 4.0e-02
pilocytic astrocytoma 2.600 3.6e-05
non primary Sjogren syndrome sicca 1.100 1.6e-02
severe Alzheimer's disease -1.049 4.9e-02
breast carcinoma -1.200 7.8e-07
Breast cancer -3.500 4.0e-05
pituitary cancer -2.800 6.5e-04

Protein-protein Interaction (2)

Gene RIF (42)

PMID Text
25389781 FABP7 and HMGCS2 may have roles in apocrine differentiation categorizing apocrine carcinoma of the breast
25192834 FABP7 is overexpressed in clear cell renal cell carcinoma and promotes cell growth by the activation of ERK and Stat3 signaling pathways
25114248 identified 98 transposable element-FABP7 gene chimeric transcripts that were exclusively expressed in primary diffuse large B-cell lymphoma (DLBCL) cases and confirmed several in DLBCL-derived cell lines
25027319 The frameshift and missense mutations in FABP3, FABP5, and FABP7 genes have been identified in schizophrenia and autism spectrum disorder in humans and in mouse behavioral studies.
24966941 The mRNA/protein expressions of FABP7 was lower in the stenotic colon segment tissue than in the normal colon segment tissue of Hirschsrung disease patients.
24932636 These results suggest an important role of Rev-erbalpha and Fabp7 in adult neurogenesis.
24274717 Our data introduces FABP7 as a marker for glioma stem cells and further highlights its possible significance for glioma diagnosis and treatment.
24114376 FABP7 and FABP5 are differentially expressed in oligodendrocyte lineage cells and regulate their proliferation and/or differentiation.
23284888 FABP7 is almost exclusively expressed in neurospheres and not in the adherent cells, derived from the same glioblastoma tumor.
23020859 Report feasibility of detecting B-FABP as biomarker for ischemic brain damage during extrcorporeal circulation in coronary artery bypass grafting patients.
22689954 identified its binding target by proteomic analysis as fatty acid binding protein 7 (FABP7), also known as brain lipid binding protein) which is highly expressed in neural stem cells and localized in the cytoplasm
22583899 These data provide the first evidence of direct transactivation of the FABP7 proximal promoter by PAX6 and suggest a synergistic mechanism for PAX6 and other co-factor(s) in regulating FABP7 expression in malignant glioma.
22562177 Considerable heterogeneity in expression patterns of FABP7 within breast cancer elates to differences in biological behaviour especially in basal-like breast cancer.
22322885 A fatty acid-binding protein 7/RXRbeta pathway enhances survival and proliferation in triple-negative breast cancer.
21771320 Data show that three putative FABP7 promoter regions drive reporter gene expression in renal cell carcinoma cell lines, but not in the HEK293 cell line.
21620951 expression of BLBP in activated astrocytes negatively correlates with disease duration and in parallel with remyelination failure
21399875 BFABP is involved in cell proliferation and migration of human renal carcinoma cells.
21143341 In contrast to heart-type FABP, serum levels of brain-type FABP are elevated in a significant proportion of patients with various neurodegenerative diseases.
20834042 High FABP7 is associated with malignant glioma.
20563994 Studies indicate that three of the ten mammalian FABPs identified to date (FABP3, FABP5, FABP7) are expressed in the brain.
20057506 Observational study of gene-disease association. (HuGE Navigator)
19622156 While B-FABP is over expressed in renal cell carcinoma in comparison to normal renal tissues L-FABP appears to be reduced in tumor tissue
19608352 this study is the first to demonstrate overexpression of FABP-7 in triple-negative breast cancers
19590950 We have identified a novel subgroup of basal phenotype (BP) class of breast cancers showing FABP7 expression that have significantly better clinical outcome.
19587692 FABP7 may function as a tumor progression gene in melanoma
19554614 brain-expressed fatty-acid binding protein (FABP) genes 3, 5 and 7 may have roles in schizophrenia and bipolar disorder
19554614 Observational study of gene-disease association. (HuGE Navigator)
19540848 NFI family of transcription factors plays a key role in the regulation of both the B-FABP and GFAP genes in malignant glioma cells.
18826602 High expression of FABP7 is associated with melanoma
18593473 Both in vitro Reelin treatment and overexpression of Notch-1 intracellular domain induced BLBP expression and a radial glial phenotype in an immortalized human neural progenitor cell line, isolated from the cortex of 14 weeks old fetus
18391847 Decreased expression of FABP-7 in fetal cystic adenomatoid malformation (CCAM) suggests FABP-7 may have a role in pulmonary development and in the pathogenesis of CCAM.
17898869 B-FABP expression in malignant glioma cells is accompanied by the appearance of radial glial-like properties, as well as reduced transformation. B-FABP depletion results in decreased migration, reduction in cell processes, & a more transformed phenotype.
17646957 Upregulation of FABP7 in renal cell carcinoma was confirmed by quantitative RT-PCR.
17428383 There were not significant difference in B-FABP expression between ductal infiltrating carcinoma and benign tissue in human breast cancer.
17415524 relation between FABP7, astrocytic features, invasion and poor prognosis and suggests that EGFR amplification is associated with nuclear translocation of FABP7.
16623952 A possible mechanism for the association of nuclear FABP7 & poor prognosis of glioblastoma multiforme is that nuclear FABP7 may be induced by EGFR activation to promote migration of GBM tumor cells.
15827123 Increases tumor cell motility in vitro and over-expression is associated with poor prognosis in glioblastoma patients
12975368 data indicate that MRG is a mediator of the differentiating effects of pregnancy on breast epithelium
12975368 Functional analysis in mice.
12771203 Overexpression of FABP7 in Down syndrome fetal brains.
12612091 BLBP, stimulated by Ras-independent pathways, regulates Schwann cell-axon interactions in normal peripheral nerve and peripheral nerve tumors.
12479569 overall structure exhibits the typical backbone conformation described for other members of the FABP family, consisting of antiparallel beta-strands that form two almost orthogonal beta-sheets, a helix-turn-helix motif and a short N-terminal helical loop

AA Sequence

MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEE      1 - 70
FDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA             71 - 132
//

Text Mined References (57)

PMID Year Title
25785516 2015 Human endogenous retrovirus group E and its involvement in diseases.
25389781 2014 FABP7 and HMGCS2 are novel protein markers for apocrine differentiation categorizing apocrine carcinoma of the breast.
25192834 2015 Overexpression of FABP7 promotes cell growth and predicts poor prognosis of clear cell renal cell carcinoma.
25114248 2014 Distinct isoform of FABP7 revealed by screening for retroelement-activated genes in diffuse large B-cell lymphoma.
25027319 2014 Functional characterization of FABP3, 5 and 7 gene variants identified in schizophrenia and autism spectrum disorder and mouse behavioral studies.
24966941 2014 Differential expressions of BMPR1?, ACTN4? and FABP7 in Hirschsprung disease.
24932636 2014 The nuclear receptor REV-ERB? regulates Fabp7 and modulates adult hippocampal neurogenesis.
24274717 2013 Fatty acid binding protein 7 as a marker of glioma stem cells.
24114376 2013 Differential expression and regulatory roles of FABP5 and FABP7 in oligodendrocyte lineage cells.
23284888 2012 A radial glia gene marker, fatty acid binding protein 7 (FABP7), is involved in proliferation and invasion of glioblastoma cells.
23020859 2013 Effect of minimized perfusion circuit on brain injury markers carnosinase and brain-type fatty binding protein in coronary artery bypass grafting patients.
22689954 2012 Neural stem cell specific fluorescent chemical probe binding to FABP7.
22583899 2012 Regulation of the FABP7 gene by PAX6 in malignant glioma cells.
22562177 2012 Fatty acid binding protein 7 expression and its sub-cellular localization in breast cancer.
22322885 2012 A fatty acid-binding protein 7/RXR? pathway enhances survival and proliferation in triple-negative breast cancer.
21771320 2011 Analysis of the regulation of fatty acid binding protein 7 expression in human renal carcinoma cell lines.
21620951 2011 BLBP-expression in astrocytes during experimental demyelination and in human multiple sclerosis lesions.
21399875 2011 Importance of brain?type fatty acid binding protein for cell-biological processes in human renal carcinoma cells.
21143341 2011 Brain-specific fatty acid-binding protein is elevated in serum of patients with dementia-related diseases.
20834042 2010 Brain fatty acid-binding protein and omega-3/omega-6 fatty acids: mechanistic insight into malignant glioma cell migration.
20563994 2010 Fatty acid binding proteins in brain development and disease.
20057506 2010 Polymorphism screening of brain-expressed FABP7, 5 and 3 genes and association studies in autism and schizophrenia in Japanese subjects.
19622156 2009 Brain-type and liver-type fatty acid-binding proteins: new tumor markers for renal cancer?
19608352 2010 Overexpression of fatty acid binding protein-7 correlates with basal-like subtype of breast cancer.
19590950 2010 The proteins FABP7 and OATP2 are associated with the basal phenotype and patient outcome in human breast cancer.
19587692 2010 Aberrant fatty acid-binding protein-7 gene expression in cutaneous malignant melanoma.
19554614 2010 Association analyses between brain-expressed fatty-acid binding protein (FABP) genes and schizophrenia and bipolar disorder.
19540848 2009 Nuclear factor I regulates brain fatty acid-binding protein and glial fibrillary acidic protein gene expression in malignant glioma cell lines.
18826602 2008 The fatty acid binding protein 7 (FABP7) is involved in proliferation and invasion of melanoma cells.
18593473 2008 Reelin induces a radial glial phenotype in human neural progenitor cells by activation of Notch-1.
18391847 2008 Genetic analysis of congenital cystic adenomatoid malformation reveals a novel pulmonary gene: fatty acid binding protein-7 (brain type).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17898869 2007 B-FABP-expressing radial glial cells: the malignant glioma cell of origin?
17646957 2007 [Transcriptome analyses in renal cell carcinoma. Combination of laser microdissection and microarrays].
17428383 2007 [Expression of fatty acid binding protein in human breast cancer tissues].
17415524 2007 FABP7 expression in glioblastomas: relation to prognosis, invasion and EGFR status.
16623952 2006 Nuclear FABP7 immunoreactivity is preferentially expressed in infiltrative glioma and is associated with poor prognosis in EGFR-overexpressing glioblastoma.
15900300 2005 Analysis of differential gene expression in human melanocytic tumour lesions by custom made oligonucleotide arrays.
15879553 2005 Brain lipid-binding protein is a direct target of Notch signaling in radial glial cells.
15827123 2005 Gene expression profiling reveals molecularly and clinically distinct subtypes of glioblastoma multiforme.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975368 2003 Induction of mammary gland differentiation in transgenic mice by the fatty acid-binding protein MRG.
12771203 2003 Overexpression of FABP7 in Down syndrome fetal brains is associated with PKNOX1 gene-dosage imbalance.
12612091 2003 Brain lipid binding protein in axon-Schwann cell interactions and peripheral nerve tumorigenesis.
12479569 2002 Solution structure of fatty acid-binding protein from human brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10854433 2000 Crystal structure and thermodynamic analysis of human brain fatty acid-binding protein.
10497880 1999 Expression of fatty acid binding proteins is altered in aged mouse brain.
9591779 1998 Correlation of B-FABP and GFAP expression in malignant glioma.
9375786 1997 Isolation and expression of a cDNA for human brain fatty acid-binding protein (B-FABP).
9250612 1997 Heart-type fatty acid binding protein - involvement in growth inhibition and differentiation.
9242429 1997 Antitumor activity of the novel human breast cancer growth inhibitor, mammary-derived growth inhibitor-related gene, MRG.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8833192 1996 Immunoreactivity for brain-fatty acid binding protein in gomori-positive astrocytes.
8798739 1996 Ligand specificity of brain lipid-binding protein.