Property Summary

NCBI Gene PubMed Count 28
PubMed Score 154.91
PubTator Score 61.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.500 1.8e-05
astrocytic glioma -1.900 4.8e-03
Astrocytoma, Pilocytic -2.700 1.3e-10
atypical teratoid / rhabdoid tumor -2.700 3.5e-11
chronic rhinosinusitis -1.672 4.8e-02
ependymoma -1.700 4.8e-04
glioblastoma -1.600 8.8e-03
group 3 medulloblastoma -1.800 7.8e-03
interstitial cystitis -2.300 2.6e-03
intraductal papillary-mucinous adenoma (... 1.400 2.9e-02
intraductal papillary-mucinous carcinoma... 1.700 4.5e-02
intraductal papillary-mucinous neoplasm ... 3.400 1.9e-04
lung cancer 1.500 2.9e-03
lung carcinoma 1.200 2.0e-03
oligodendroglioma -1.500 2.5e-02
ovarian cancer 1.600 1.5e-02

Gene RIF (15)

AA Sequence

MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKES      1 - 70
NIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA                 71 - 128
//

Text Mined References (30)

PMID Year Title