Property Summary

NCBI Gene PubMed Count 28
PubMed Score 142.91
PubTator Score 61.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.900 4.8e-03
oligodendroglioma -1.500 2.5e-02
ependymoma -1.700 4.8e-04
glioblastoma -1.900 9.3e-04
group 3 medulloblastoma -1.800 7.8e-03
atypical teratoid/rhabdoid tumor -2.800 7.7e-12
intraductal papillary-mucinous adenoma (... 1.400 2.9e-02
intraductal papillary-mucinous carcinoma... 1.700 4.5e-02
intraductal papillary-mucinous neoplasm ... 3.400 1.9e-04
lung cancer 1.500 2.9e-03
interstitial cystitis -2.300 2.6e-03
adult high grade glioma -2.500 1.8e-05
pilocytic astrocytoma -2.700 4.1e-11
lung carcinoma 1.200 2.0e-03
ovarian cancer 1.600 1.5e-02
chronic rhinosinusitis -1.672 4.8e-02

Gene RIF (15)

PMID Text
26613247 Structural determinants of ligand binding in the ternary complex of human ileal bile acid binding protein with glycocholate and glycochenodeoxycholate obtained from solution NMR
25073073 Analysis of slow and fast motions in I-BABP indicates largely different energy landscapes for the apo and holo states suggesting that optimization of binding interactions might be achieved by altering the dynamic behavior of specific protein segments.
23758264 show, using electrospray ionization mass spectroscopy, that human ILBP binds bile acids with a 3:1 ratio, even at low protein and ligand concentrations
22329738 NMR data are in agreement with a conformational selection model we proposed earlier for I-BABP and support the hypothesis of an allosteric mechanism of ligand binding
22223860 Ursodeoxycholic acid induces unique conformational changes in IBABP.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19744871 The-putative functional-Thr79Met substitution of FABP6 confers a protective effect on type 2 diabetes in obese individuals.
19744871 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17266179 Observational study of gene-disease association. (HuGE Navigator)
16951225 The expression of FABP6 was higher in primary colorectal cancers and adenomas than in normal epithelium, but was dramatically decreased in lymph node metastases, suggesting that FABP6 may play an important role in early carcinogenesis.
16237211 ASBT and ILBP protein were 48% and 67% lower in normal weight gallstone carriers than in controls (P < 0.05); similar differences were found for mRNA expression levels.
15936983 the I-BABP gene may be a novel target for PPAR in humans
14654244 In keeping with its role in the enterohepatic circulation and ileal reabsorption of bile acids, the gene promoter contains consensus elements for CDX2 and FXR. More than one transcription start site has been identified.
12486725 NMR structure of human ileal lipid-binding protein-cholyltaurine complex and its comparison with homologous structures

AA Sequence

MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKES      1 - 70
NIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA                 71 - 128
//

Text Mined References (30)

PMID Year Title
26613247 2016 Structural determinants of ligand binding in the ternary complex of human ileal bile acid binding protein with glycocholate and glycochenodeoxycholate obtained from solution NMR.
25073073 2014 Temperature dependence of backbone dynamics in human ileal bile acid-binding protein: implications for the mechanism of ligand binding.
23758264 2013 Cooperativity and site selectivity in the ileal lipid binding protein.
22329738 2012 Internal motions and exchange processes in human ileal bile acid binding protein as studied by backbone (15)N nuclear magnetic resonance spectroscopy.
22223860 2012 Unusual binding of ursodeoxycholic acid to ileal bile acid binding protein: role in activation of FXR?.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19744871 2009 Evidence for the Thr79Met polymorphism of the ileal fatty acid binding protein (FABP6) to be associated with type 2 diabetes in obese individuals.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17909007 2007 A novel variant of ileal bile acid binding protein is up-regulated through nuclear factor-kappaB activation in colorectal adenocarcinoma.
17266179 2007 Candidate gene association study of type 2 diabetes in a nested case-control study of the EPIC-Potsdam cohort - role of fat assimilation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16951225 2006 Fatty acid binding protein 6 is overexpressed in colorectal cancer.
16237211 2006 Apical sodium bile acid transporter and ileal lipid binding protein in gallstone carriers.
15936983 2005 The gene encoding the human ileal bile acid-binding protein (I-BABP) is regulated by peroxisome proliferator-activated receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654244 2003 Human ileal bile acid-binding protein promoter and the effects of CDX2.
12486725 2003 Insights into the bile acid transportation system: the human ileal lipid-binding protein-cholyltaurine complex and its comparison with homologous structures.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11461829 2001 Ligand specificity and conformational stability of human fatty acid-binding proteins.
10806391 2000 Solution structure of ileal lipid binding protein in complex with glycocholate.
10514450 1999 Identification of a bile acid-responsive element in the human ileal bile acid-binding protein gene. Involvement of the farnesoid X receptor/9-cis-retinoic acid receptor heterodimer.
9250612 1997 Heart-type fatty acid binding protein - involvement in growth inhibition and differentiation.
8805562 1996 Flexibility is a likely determinant of binding specificity in the case of ileal lipid binding protein.
8527237 1995 Immunohistochemical distribution of intestinal 15 kDa protein in human tissues.
7894165 1994 Ileal lipid-binding protein (Illbp) gene maps to mouse chromosome 11.
7619861 1995 Cloning and chromosomal localization of the human ileal lipid-binding protein.
7588781 1995 Molecular cloning, expression, and characterization of a human intestinal 15-kDa protein.