Property Summary

NCBI Gene PubMed Count 1
PubMed Score 125.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung adenocarcinoma 2714 1.2e-05
Breast cancer 3098 1.7e-04
Disease Target Count Z-score Confidence
Globe disease 57 0.0 2.0
Disease Target Count Z-score Confidence
psoriasis 6685 3.629 1.8
Irritant dermatitis 9 3.507 1.8
Cancer 2346 3.142 1.6

AA Sequence

MGAMAKPDCIITCDSKNLTIKTESTLKTTQFSGTLGEKFEENTADGRRTQTVCNFTDGALVQHQEWDGKE      1 - 70
STITRKLKDGKLVVERVMNHVACTRIYEKAQ                                            71 - 101
//

Text Mined References (1)

PMID Year Title
12853948 2003 The DNA sequence of human chromosome 7.