Property Summary

Ligand Count 24
NCBI Gene PubMed Count 118
PubMed Score 1104.30
PubTator Score 401.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease -1.104 3.1e-03
active ulcerative colitis -1.472 1.2e-03
acute quadriplegic myopathy -2.019 1.3e-05
adult high grade glioma -2.600 1.3e-03
astrocytic glioma -2.900 3.8e-03
Astrocytoma, Pilocytic -2.100 2.1e-04
atypical teratoid / rhabdoid tumor -3.600 8.9e-09
dermatomyositis -1.300 2.2e-03
ependymoma -3.100 5.9e-03
gastric carcinoma -1.200 4.3e-02
glioblastoma -1.900 4.6e-05
group 4 medulloblastoma -2.800 3.1e-04
juvenile dermatomyositis -1.313 5.3e-06
limb girdle muscular dystrophy 2A -1.137 2.4e-03
lung cancer -1.500 1.0e-03
lung carcinoma -2.400 7.2e-10
malignant mesothelioma 5.700 4.9e-10
medulloblastoma, large-cell -3.500 4.3e-04
mucosa-associated lymphoid tissue lympho... 2.619 4.7e-02
oligodendroglioma -2.700 7.0e-03
osteosarcoma -3.073 2.7e-06
Pick disease -1.200 5.6e-04
pituitary cancer 1.100 4.3e-03
primitive neuroectodermal tumor -2.800 7.8e-04
psoriasis -3.000 1.8e-04

PDB (19)

Gene RIF (93)

AA Sequence

MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVE      1 - 70
FDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA            71 - 133
//

Text Mined References (121)

PMID Year Title