Property Summary

NCBI Gene PubMed Count 108
PubMed Score 1058.79
PubTator Score 401.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma 5.700 4.9e-10
astrocytic glioma -2.900 3.8e-03
ependymoma -3.100 5.9e-03
oligodendroglioma -2.700 7.0e-03
psoriasis -3.000 1.8e-04
glioblastoma -3.200 1.1e-05
osteosarcoma -3.073 2.7e-06
medulloblastoma -3.000 9.1e-06
atypical teratoid / rhabdoid tumor -3.600 8.9e-09
medulloblastoma, large-cell -3.500 4.3e-04
primitive neuroectodermal tumor -2.800 7.8e-04
juvenile dermatomyositis -1.313 5.3e-06
acute quadriplegic myopathy -2.019 1.3e-05
limb girdle muscular dystrophy 2A -1.137 2.4e-03
lung cancer -3.100 1.5e-05
active Crohn's disease -1.104 3.1e-03
active ulcerative colitis -1.472 1.2e-03
adult high grade glioma -2.600 1.3e-03
pilocytic astrocytoma -2.100 2.8e-04
lung carcinoma -2.400 7.2e-10
Pick disease -1.200 5.6e-04
gastric carcinoma -1.200 4.3e-02
mucosa-associated lymphoid tissue lympho... 2.619 4.7e-02
pituitary cancer 1.100 4.3e-03
dermatomyositis -1.300 2.2e-03

Synonym

Accession P05413 B2RAB6 Q5VV93 Q99957
Symbols MDGI
FABP11
H-FABP
M-FABP
O-FABP

Gene

PDB

1G5W   1HMR   1HMS   1HMT   2HMB   3RSW   3WBG   3WVM   3WXQ   4TJZ   4TKB   4TKH   4TKJ   4WBK   5CE4  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (84)

PMID Text
26484922 This study demonstrated that CSF FABP-3 may be an early marker for later development of dementia.
26212703 Bedside H-FABP measurements may contribute to correct early diagnoses, as its levels are elevated soon following myocardial infarction, and measurement is easy, with a rapid result.
26206228 polymorphism affects fatty acid-binding protein 3 intracellular stability and subcellular localization
26072112 FABP3 was increased in patients with acute heart failure compared to those without.
25830762 Perioperative plasma H-FABP levels may be used for risk stratification of acute kidney injury and mortality following cardiac surgery.
25456730 H-FABP may have a role in occurrence of adverse clinical outcome in pulmonary embolism [meta-analysis]
25234940 Serum H-FABP levels progressively increased from the control group to the OH group.
25212385 Report correlation between preoperative serum h-FABP and the postoperative incidence of acute kidney injury in cardiac surgery patients.
25147067 Elevated H-FABP serum levels in patients with essential hypertension were predictive of future cardiovascular events.
25027319 The frameshift and missense mutations in FABP3, FABP5, and FABP7 genes have been identified in schizophrenia and autism spectrum disorder in humans and in mouse behavioral studies.
24899611 The levels of H-FABP, NT-proBNP, and cTnI were correlated with heart function, and can be used for the diagnosis of early-stageheart failure in children with congenital heart disease
24847804 H-FABP level was increased in association with greater numbers of cardiovascular risk factors and was an independent risk factor for all-cause and cardiovascular deaths.
24817549 The s-H-FABP level is an effective biomarker for risk stratification in non-surgical intensive care patients.
24785584 plasma level of H-FABP at 24h after the event may be an early and independent factor associated with survival to discharge in out-of-hospital cardiac arrest
24695477 The C/G-G/G haplotype at RS2271072 and RS10914367 single nucleotide polymorphism of FABP3 might be a prognostic factor in patients with coronary atherosclerosis.
24583397 Overexpression of FABP3 inhibited cell growth and proliferation via negative regulation of the cell cycle and down-regulation of cell growth factors, but enhances cell survival in hypoxic or ischemic conditions.
24493698 Results show that MDGI is expressed in human brain tumor specimens in a grade-dependent manner and its expression positively correlated with the histologic grade of the tumor, suggesting MDGI as a novel marker for malignant gliomas.
24264959 Despite, h-FABP was successful to predict 30-days mortality in patients with PE at intermediate risk; it is suggested to be failed in determining the patients who will benefit from thrl therapy.
24164992 Studied the relationship between severity of CAD and heart-type fatty acid-binding protein (H-FABP)in patients with non-ST-segment elevation acute coronary syndrome.
24088526 Our findings indicate that Abeta-associated volume loss occurs in the presence of elevated HFABP irrespective of phospho-tau
23734811 High peripheral levels of h-FABP are associated with poor prognosis in end-stage heart failure patients with mechanical circulatory support.
23635017 One-year increases in skin autofluorescence and plasma H-FABP, used separately and in combination, are strong predictors of overall and cardiovascular mortality in hemodyalisis patients.
23591828 Heart-type fatty acid binding protein (hFABP) and VEGF CSF concentrations distinguished between healthy controls and patients with AD dementia with a sensitivity and specificity of 57 and 35%, and 76 and 84%, respectively
23590685 Patients with multi-trauma had significantly higher H-FABP concentrations at 24 and 48 h
23510163 The methylation status of FABP3 is associated with phenotypes of metabolic syndrome.
23497639 A combination of FABP3 and IL-6 has an additive clinical value for prediction of cerebral infarction outcome.
23483223 H-FABP is related to MetS and FAC status in asymptomatic SCI patients.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of fatty acid binding protein 3 (FABP3) in peptide-treated PBMCs
23332896 The H-FABP rapid test provides additional diagnostic certainty in suspected acute coronary syndrome.
23328883 the addition of H-FABP significantly enhanced the sensitivity and accuracy of diagnosis as compared to a prior-generation troponin assay alone, especially in patients who presented early
23291993 Elevated serum H-FABP during the convalescent stage of AMI predicted long-term mortality and readmission for HF after survival discharge in the post-AMI patients.
23254629 The early stages of Alzheimer's disease and vascular dementia have elevated cerebrospinal fluid levels of FABP protein compared to controls.
23093954 investigation of H-FABP as biomarker for metabolic disorders: Data suggest that serum H-FABP levels are higher in subjects with insulin resistance and metabolic syndrome than in subjects without such metabolic disorders regardless of gender.
23029183 study confirmed an association of H-FABP with the pathogenesis of clinical and experimental obesity-related glomerulopathy, and suggests that such a process might be related to podocytes and lipid dysmetabolism
22838188 H-FABP and GPBB can contribute to early acute myocardial infarction diagnosis and can distinguish acute myocardial infarction from acute coronary syndrome
22766253 plasma h-fabp was correlated with initial stroke score, and was significantly higher in patients with poor clinical outcome
22396741 Common variants of the liver fatty acid binding protein genes 1-4 influence the risk of type 2 diabetes and insulin resistance in Spanish population
22222353 Measurement of urinary proteins is a powerful and non-invasive method to quantify the effect of patent ductus arteriosus on systemic perfusion in preterm infants.
22078394 Measurement of heart-type FABP in patients with acute myocardial infarction shows no improvement for early diagnosis compared with sensitive troponin assay.
22044705 Measurement of h-FABP was insufficient to be used as a marker of acute coronary syndrome and myocardial infarction in hospital emergency department, whatever the analytical technique used.
21937835 H-FABP offers similar overall diagnostic performance, while the combination of H-FABP and MPO assays may improve the diagnosis of ACS, particularly in patients with recent onset of chest pain.
21729325 Levels of highly sensitive troponin T and heart fatty acid binding protein are significantly higher in patients with asymptomatic left ventricular diastolic function and heart failure patients with normal ejection fraction, compared to controls.
21617322 H-FABP could serve as a new monitoring tool to provide information that will guide the optimal therapy and management of CHD patients.
21535886 H-FABP may represent a marker for early carotid atherosclerosis in prediabetic patients.
21307379 Urinary NAG (ninefold), NGAL (1.5-fold), and H-FABP (3.5-fold) were significantly elevated in normoalbuminuric diabetic patients compared with nondiabetic control subjects.
21143341 In contrast to heart-type FABP, serum levels of brain-type FABP are elevated in a significant proportion of patients with various neurodegenerative diseases.
20930282 HFABP levels were higher in Alzheimer (AD) patients and in Mild Cognitive Impairment converting to AD (MCI-AD) with respect to other neurological disorders and to cognitively stable MCI patients (MCI-MCI).
20834198 Data show that patients with acromegaly have increased levels of H-FABP, and suggest that serum H-FABP levels might be a marker of myocardial performance in patients with acromegaly.
20821366 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20802519 FABP-3 binds directly to the cytoplasmic tail of integrin alpha-subunits and its expression inhibits integrin activity, resulting in inhiibition of cell invasion.
20716856 This review identifies a novel binding protein, heart-type fatty acid-binding protein which interacts with domapine D2 receptor.
20709047 h-FABP may be an early parameter for monitoring radiofrequency ablation-induced lesions and the site of ablation was relevant for biomarker increase.
20691835 Heart-type fatty acid-binding protein is significantly associated with right ventricular dysfunction and predicts mortality in patients with pulmonary embolism at intermediate risk.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20563994 Studies indicate that three of the ten mammalian FABPs identified to date (FABP3, FABP5, FABP7) are expressed in the brain.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20457766 Compared with traditional markers of myocardial injury after coronary artery bypass grafting, hFABP peaks earlier and is a superior independent predictor of postoperative mortality and ventricular dysfunction.
20391015 H-FABP could be soon introduced in clinical practice in combination with well-established markers like troponins
20057506 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19806479 Serum H-FABP levels were significantly higher in patients with diabetic MetS than in without diabetic MetS, 24.0 +/- 10.2 and 13.9 +/- 12.6 ng/ml, respectively.
19576209 Serum H-FABP and leptin increased simultaneously and significantly in the patients, and leptin alleviated pulmonary and intestinal injuries by restraining tissue H-FABP secretions in the mouse model of sepsis
19554614 brain-expressed fatty-acid binding protein (FABP) genes 3, 5 and 7 may have roles in schizophrenia and bipolar disorder
19554614 Observational study of gene-disease association. (HuGE Navigator)
19552571 Heart-type fatty acid-binding protein significantly increases after elective coronary angioplasty at 1 h compared with baseline values
18660489 Observational study of gene-disease association. (HuGE Navigator)
18571749 Results of H-FABP immunotest give a better diagnostic classification than cardiac troponin I at the early stage of acute myocardial infarction (AMI) in patients presenting to the Emergency Department suspected of AMI.
18469019 Identification of two previously unreported SNPs in FGFR1 and FABP3 associated with BMD and a third SNP in TIMP2 related to risk for non-vertebral osteoporotic fractures.
18469019 Observational study of gene-disease association. (HuGE Navigator)
18460953 H-FABP (heart-type fatty acid binding protein ) is a sensitive diagnostic biochemical marker of Acute Coronary Syndrome, particularly within the first 6 h of symptoms, in patients attending the emergency department.
18437121 We found an association between FABP3 gene polymorphisms and EH in a Japanese population, thereby suggesting that FABP3 is a susceptibility locus for EH.
18437121 Observational study of gene-disease association. (HuGE Navigator)
18412949 This study is the first to assess the diagnostic value of H-FABP for acute myocardial infarction outside a hospital-setting.
18256058 patients with baseline heart-type fatty acid-binding protein (H-FABP) concentrations >2.7 ng x mL(-1), the median value of the biomarker in the surgically treated population, had a lower probability of event-free survival after pulmonary endarterectomy
18159110 persistently high H-FABP levels despite improvement in symptoms and signs of CHF predicted significantly higher cardiac event rates
18021874 FABP3 predicts long-term mortality after ACS and identifies high-risk patients in a manner that is additive to clinical risk factors, troponin, and hs-CRP, possibly identifying myocardial ischemia with or without necrosis.
17826730 Hypoxia enhances the expression of FABP3 in term human trophoblasts, suggesting that fatty acid binding proteins support fat accumulation in the hypoxic placenta.
17721027 high serum H-FABP levels may represent latent cardiac injury and have important clinical implications
17428383 H-FABP may play a key role in the progress of invasiveness and metastasis in human breast cancer.
17289870 heart-type fatty acid-binding protein affects the response to gefitinib, an epidermal growth factor receptor tyrosine kinase inhibitor in lung adenocarcinoma
15459486 A subset of human gastric carcinoma expresses H-FABP and its expression is associated with FAS status, disease progression, tumor aggressiveness and poor patient survival.
15068254 Decreased heart-type FABP levels may alter lipid composition and/or fluidity in membrane of brains with degeneration, e.g., Down syndrome and Alzheimer's disease.
12872269 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVE      1 - 70
FDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA            71 - 133
//

Text Mined References (111)

PMID Year Title
26484922 2016 Cerebrospinal Fluid Fatty Acid-Binding Protein 3 is Related to Dementia Development in a Population-Based Sample of Older Adult Women Followed for 8 Years.
26212703 Comparison of a qualitative measurement of heart-type fatty acid-binding protein with other cardiac markers as an early diagnostic marker in the diagnosis of non-ST-segment elevation myocardial infarction.
26206228 2015 Asp3Gly polymorphism affects fatty acid-binding protein 3 intracellular stability and subcellular localization.
26072112 2015 Ischemic biomarker heart-type fatty acid binding protein (hFABP) in acute heart failure - diagnostic and prognostic insights compared to NT-proBNP and troponin I.
25830762 2015 Perioperative heart-type fatty acid binding protein is associated with acute kidney injury after cardiac surgery.
25456730 2015 Prognostic role of heart-type fatty acid binding protein in pulmonary embolism: a meta-analysis.
25416956 2014 A proteome-scale map of the human interactome network.
25234940 2014 Serum H-FABP levels in patients with hypothyroidism.
25212385 2014 Preoperative serum h-FABP concentration is associated with postoperative incidence of acute kidney injury in patients undergoing cardiac surgery.
25147067 2014 Heart-type fatty acid-binding protein is a novel prognostic marker in patients with essential hypertension.
25027319 2014 Functional characterization of FABP3, 5 and 7 gene variants identified in schizophrenia and autism spectrum disorder and mouse behavioral studies.
24899611 2014 Diagnostic value of analysis of H-FABP, NT-proBNP, and cTnI in heart function in children with congenital heart disease and pneumonia.
24847804 2014 Association of heart-type fatty acid-binding protein with cardiovascular risk factors and all-cause mortality in the general population: the Takahata study.
24817549 2014 Prognostic impact of the serum heart-type fatty acid-binding protein (H-FABP) levels in patients admitted to the non-surgical intensive care unit.
24785584 2014 Prognostic relevance of plasma heart-type fatty acid binding protein after out-of-hospital cardiac arrest.
24695477 2014 Polymorphisms of the heart-type fatty acid-binding protein as a prognostic factor in patients with atherosclerosis.
24583397 2014 Overexpression of FABP3 inhibits human bone marrow derived mesenchymal stem cell proliferation but enhances their survival in hypoxia.
24493698 2014 Novel target for peptide-based imaging and treatment of brain tumors.
24264959 2014 Thrombolysis in patients with pulmonary embolism and elevated heart-type fatty acid-binding protein levels.
24164992 2013 [Relation of heart-type fatty acid-binding protein with the degree and extent of atherosclerosis in patients with non-ST elevation acute coronary syndrome].
24088526 2013 Heart fatty acid binding protein and A?-associated Alzheimer's neurodegeneration.
23873799 2013 Serial measurement of hFABP and high-sensitivity troponin I post-PCI in STEMI: how fast and accurate can myocardial infarct size and no-reflow be predicted?
23734811 2013 High peripheral levels of h-FABP are associated with poor prognosis in end-stage heart failure patients with mechanical circulatory support.
23635017 2013 Increase in skin autofluorescence and release of heart-type fatty acid binding protein in plasma predicts mortality of hemodialysis patients.
23591828 2013 Heart-type fatty acid binding protein and vascular endothelial growth factor: cerebrospinal fluid biomarker candidates for Alzheimer's disease.
23590685 2013 The prognostic significance of the serum biomarker heart-fatty acidic binding protein in comparison with s100b in severe traumatic brain injury.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23510163 2013 Fatty acid binding protein 3 (fabp3) is associated with insulin, lipids and cardiovascular phenotypes of the metabolic syndrome through epigenetic modifications in a Northern European family population.
23497639 2013 Predictive value of circulating interleukin-6 and heart-type fatty acid binding protein for three months clinical outcome in acute cerebral infarction: multiple blood markers profiling study.
23483223 2013 H-FABP, cardiovascular risk factors, and functional status in asymptomatic spinal cord injury patients.
23455491 2013 NKAIN1-SERINC2 is a functional, replicable and genome-wide significant risk gene region specific for alcohol dependence in subjects of European descent.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23332896 2013 Diagnostic value of a heart-type fatty acid-binding protein (H-FABP) bedside test in suspected acute coronary syndrome in primary care.
23328883 2013 Evaluation of the diagnostic performance of heart-type fatty acid binding protein in the BWH-TIMI ED chest pain study.
23291993 2013 Elevated serum heart-type fatty acid-binding protein in the convalescent stage predicts long-term outcome in patients surviving acute myocardial infarction.
23254629 2013 Cerebrospinal fluid levels of heart fatty acid binding protein are elevated prodromally in Alzheimer's disease and vascular dementia.
23093954 2012 Impact of insulin resistance on silent and ongoing myocardial damage in normal subjects: the Takahata study.
23029183 2012 Heart-type fatty acid binding protein is associated with proteinuria in obesity.
22838188 2012 Diagnostic accuracy of heart fatty acid binding protein (H-FABP) and glycogen phosphorylase isoenzyme BB (GPBB) in diagnosis of acute myocardial infarction in patients with acute coronary syndrome.
22766253 2013 Plasma heart-type fatty acid binding protein level in acute ischemic stroke: comparative analysis with plasma S100B level for diagnosis of stroke and prediction of long-term clinical outcome.
22396741 2012 Common variants of the liver fatty acid binding protein gene influence the risk of type 2 diabetes and insulin resistance in Spanish population.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22222353 2012 Urinary NT-proBNP, NGAL, and H-FABP may predict hemodynamic relevance of patent ductus arteriosus in very low birth weight infants.
22078394 2013 Comparison of heart-type fatty acid binding protein and sensitive troponin for the diagnosis of early acute myocardial infarction.
22044705 2011 Diagnostic accuracy of quantitative heart-fatty acid binding protein assays compared with Cardiodetect(®) in the early detection of acute coronary syndrome.
21937835 2011 Heart fatty acid-binding protein offers similar diagnostic performance to high-sensitivity troponin T in emergency room patients presenting with chest pain.
21729325 2011 High sensitive troponin T and heart fatty acid binding protein: novel biomarker in heart failure with normal ejection fraction? A cross-sectional study.
21617322 2011 Serum concentration of heart-type fatty acid-binding protein in children and adolescents with congenital heart disease.
21535886 2011 Heart-type fatty acid binding protein (H-FABP): relationship with arterial intima-media thickness and role as diagnostic marker for atherosclerosis in patients with ?mpaired glucose metabolism.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21307379 2011 Glomerular and tubular damage markers are elevated in patients with diabetes.
21143341 2011 Brain-specific fatty acid-binding protein is elevated in serum of patients with dementia-related diseases.
20930282 2010 CSF levels of heart fatty acid binding protein are altered during early phases of Alzheimer's disease.
20834198 2011 Serum heart-type fatty acid binding protein levels in acromegaly patients.
20821366 2011 Association study of energy homeostasis genes and antipsychotic-induced weight gain in patients with schizophrenia.
20802519 2010 Mammary-derived growth inhibitor (MDGI) interacts with integrin ?-subunits and suppresses integrin activity and invasion.
20716856 2010 Advanced research on dopamine signaling to develop drugs for the treatment of mental disorders: proteins interacting with the third cytoplasmic loop of dopamine D2 and D3 receptors.
20709047 2010 Heart-type fatty acid binding protein is an early marker of myocardial damage after radiofrequency catheter ablation.
20691835 2010 Correlation of heart-type fatty acid-binding protein with mortality and echocardiographic data in patients with pulmonary embolism at intermediate risk.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20563994 2010 Fatty acid binding proteins in brain development and disease.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20457766 2010 Heart-type fatty acid binding protein is an independent predictor of death and ventricular dysfunction after coronary artery bypass graft surgery.
20391015 2010 A one-step immunotest for rapid detection of heart-type fatty acid-binding protein in patients with acute coronary syndromes.
20057506 2010 Polymorphism screening of brain-expressed FABP7, 5 and 3 genes and association studies in autism and schizophrenia in Japanese subjects.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19806479 2009 Serum heart type fatty acid binding protein levels in metabolic syndrome.
19576209 2009 Heart-type fatty acid-binding protein is a useful marker for organ dysfunction and leptin alleviates sepsis-induced organ injuries by restraining its tissue levels.
19554614 2010 Association analyses between brain-expressed fatty-acid binding protein (FABP) genes and schizophrenia and bipolar disorder.
19552571 2009 Increases in serum concentration of human heart-type fatty acid-binding protein following elective coronary intervention.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18571749 2009 Human heart-type fatty acid-binding protein for on-site diagnosis of early acute myocardial infarction.
18469019 2008 Single nucleotide polymorphisms in new candidate genes are associated with bone mineral density and fracture risk.
18460953 2008 Clinical assessment of heart-type fatty acid binding protein in early diagnosis of acute coronary syndrome.
18437121 2008 Association between fatty acid binding protein 3 gene variants and essential hypertension in humans.
18412949 2008 Heart-type Fatty acid-binding protein in Acute Myocardial infarction Evaluation (FAME): background and design of a diagnostic study in primary care.
18256058 2008 Heart-type fatty acid-binding protein for risk assessment of chronic thromboembolic pulmonary hypertension.
18159110 2008 Persistently increased serum concentration of heart-type fatty acid-binding protein predicts adverse clinical outcomes in patients with chronic heart failure.
18021874 2007 Heart-type fatty acid-binding protein predicts long-term mortality after acute coronary syndrome and identifies high-risk patients across the range of troponin values.
17987659 2008 Nebulette interacts with filamin C.
17826730 2007 Hypoxia regulates the expression of fatty acid-binding proteins in primary term human trophoblasts.
17721027 2007 Circulating levels of heart-type fatty acid-binding protein in a general Japanese population: effects of age, gender, and physiologic characteristics.
17428383 2007 [Expression of fatty acid binding protein in human breast cancer tissues].
17289870 2007 Proteomic signature corresponding to the response to gefitinib (Iressa, ZD1839), an epidermal growth factor receptor tyrosine kinase inhibitor in lung adenocarcinoma.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16429158 2006 Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459486 2004 Expression of heart-type fatty acid-binding protein in human gastric carcinoma and its association with tumor aggressiveness, metastasis and poor prognosis.
15068254 2003 Heart type fatty acid binding protein (H-FABP) is decreased in brains of patients with Down syndrome and Alzheimer's disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12872269 2003 Polymorphisms in fatty acid-binding protein-3 (FABP3) - putative association with type 2 diabetes mellitus.
12721663 2003 Cloning and characterization of a novel cardiac-specific kinase that interacts specifically with cardiac troponin I.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11171102 2001 Spin-system heterogeneities indicate a selected-fit mechanism in fatty acid binding to heart-type fatty acid-binding protein (H-FABP).
8661024 1996 The human mammary-derived growth inhibitor (MDGI) gene: genomic structure and mutation analysis in human breast tumors.
8326460 1993 Immunohistochemical distribution of heart-type fatty acid-binding protein immunoreactivity in normal human tissues and in acute myocardial infarct.
8262516 1993 Localization of the gene for human heart fatty acid binding protein to chromosome 1p32-1p33.
7962070 1994 Members of the fatty acid binding protein family are differentiation factors for the mammary gland.
7922029 1994 Structural studies on human muscle fatty acid binding protein at 1.4 A resolution: binding interactions with three C18 fatty acids.
7757968 1995 Tumor suppressor activity of the gene encoding mammary-derived growth inhibitor.
7691977 1993 Fatty acid-binding protein from rat heart is phosphorylated on Tyr19 in response to insulin stimulation.
7498159 1995 The major protein expression profile and two-dimensional protein database of human heart.
3421901 1988 Characterization and amino acid sequence of a fatty acid-binding protein from human heart.
2266970 1990 Characteristics of fatty acid-binding proteins and their relation to mammary-derived growth inhibitor.
2266954 1990 Revision of the amino acid sequence of human heart fatty acid-binding protein.
2040092 1991 Serum and urinary human heart fatty acid-binding protein in acute myocardial infarction.
1710107 1991 Cloning of the cDNA encoding human skeletal-muscle fatty-acid-binding protein, its peptide sequence and chromosomal localization.
1526991 1992 Three-dimensional structure of recombinant human muscle fatty acid-binding protein.