Property Summary

NCBI Gene PubMed Count 176
PubMed Score 381.14
PubTator Score 385.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.400 2.7e-07

Synonym

Accession P12104 Q2NKJ1
Symbols FABPI
I-FABP

Gene

PDB

1KZW   1KZX   2MJI   2MO5   3AKM   3IFB  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (190)

PMID Text
27110575 Urinary intestinal fatty acid-binding protein can distinguish necrotizing enterocolitis from sepsis in early stage of the disease.
26798632 I-FABP is a valid serologic biomarker for early diagnosis in NEC for the premature neonates with a moderate accuracy.
26703680 Ala54Thr polymorphism of FABP2 modulates HDL cholesterol in Mexican-Americans with type 2 diabetes.
26316042 Carriers of the Thr54 allele in FABP2 have a different metabolic response after weight loss than wild type non-A obese carriers
26238699 To determine the allele/genotype frequencies of Ala54Thr polymorphism of the FABP2 gene.
26114190 Letter: serum intestinal-fatty acid binding protein may serve as a biomarker for refractory celiac disease.
26019038 Ala54Thr polymorphism of FABP2 was associated with high triglycerides levels, but not to gallstone disease.
25847235 FABP1 and FABP2 have roles in differentially modulating the activation of PPARalpha in a ligand-selective manner
25807642 systemic marker for Crohn disease activity
25793701 Both plasma and urinary I-FABP levels specifically identify necrotizing enterocolitis in preterm infants.
25730055 FABP2 Ala54Thr polymorphism may have a role in type 2 diabetes, obesity, and metabolic syndrome [case-control study and meta-analysis]
25594612 FABP2 is a gene candidate for predisposition to Diabetic nephropathy, as it has been linked to microalbuminuria in patients with Type 2 Diabetes mellitus.
25388378 Studies suggest that the fatty acid binding protein 2 (FABP2) Ala54Thr polymorphisms (rs1799883) are associated with increased susceptibility to type 2 diabetes mellitus risk (T2DM) risk among Asians but not Caucasians.
25357227 It is concluded that ACE (rs 4646994), FABP2 (rs1799883) and GST (GSTM1 null or positive genotype and GSTT1 null or positive genotype) genes polymorphism are associated with essential hypertension.
25324448 I-FABP and L-FABP are early markers for abdominal injury with limited prognostic value for secondary organ failures in the post-traumatic course
25262933 Ala54Thr of FABP2 may be not associated with stroke risk but associated with plasma triglyceride level of stroke patients for Hunan Han population of China.
24956227 Increasing gestational age is accompanied by an increase in ileal I-FABP tissue content.
24690233 The study suggests that the above named variant in FABP2 gene is not potential contributor to the risk of T2DM and related traits in a Saudi population.
24640155 FABP2 gene Ala54Thr polymorphism is associated with the predisposition to physical endurance and is not associated with risk of obesity and body fat mass.
24340071 the Ala54Thr fatty acid-binding protein 2 (FABP2) polymorphism may have a role in recurrent depression and is associated with fatty acid concentrations and waist circumference
24100750 Systemic I-FABP levels appear valuable in detecting irreversible intestinal ischemia-reperfusion damage.
23911300 Polymorphisms in FABP2 and APOL6, located at the predicted miRNAs binding sites, are identified to contribute to susceptibility to MetS in the Chinese Han population.
23817228 Carriers of Thr54 allele of FABP2 have a different response than wild type obese, with a lack of decrease of insulin levels, leptin levels and HOMA-Insulin resistance.
23468166 ACE (I/D) and FABP2 (Ala54Thr) genes polymorphism and its susceptibility to type 2 diabetes mellitus in the North Indian population, was studied.
23362142 results suggest that the higher cardiorespiratory fitness may attenuate the changes in central arterial stiffness and blood pressure that are associated with the FABP2 genotype
23303383 INSR rs1366600, ACSL1 rs2292899 and FABP2 rs11724758 could influence the susceptibility to type 2 diabetes in Chinese Han population, most likely through their effects on the specific miRNA-binding sites.
23072901 FABP2 Thr54 carriers have a better metabolic response than obese carriers with Ala54Ala genotype to high-polyunsaturated dietary fats.
22838187 FABP2 genetic polymorphism is associated with lower triglyceride and higher HDL-cholesterol concentrations in elderly subjects with MetS
22817827 Thr54 allele carriers responded better to a moderate-fat diet in overweight or obese subjects.
22396741 Common variants of the liver fatty acid binding protein genes 1-4 influence the risk of type 2 diabetes and insulin resistance in Spanish population
21861348 Mutation frequency of FABP2 gene in the people with dyslipidemia was significantly higher than that in the people with normal blood lipids.
21840466 We hypothesized that the triglyceride-rich lipoproteins response to diets of varied fat content is affected by the FABP2 A54T polymorphism....no evidence of an interaction, which does not support our hypothesis.
21767383 Data show that IL-FABP mRNA was over-expressed in renal tumour tissue.
21355293 The Ala54Thr polymorphism in the FABP2 gene was not associated with obesity in the Chinese Han population of the Chengdu area.
21288588 The findings suggest a potential distinct role(s) of SNPs in FABP5 and FABP2 genes in T2DM in different populations.
21079390 Observational study of gene-disease association. (HuGE Navigator)
20723947 The finding of ths study was the lack of association of the Thr54/Ala54 and Thr54/Thr54 fatty acid binding protein 2 genotypes with metabolic syndrome.
20723947 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20621703 meta-analysis does not support the association between the FABP2 Ala54Thr polymorphism and body mass index
20621703 Meta-analysis of gene-disease association. (HuGE Navigator)
20578207 Thr54 allele of the FABP2 Ala54Thr is weakly associated with a higher degree of insulin resistance, higher level of fasting insulin and higher level of 2-h blood glucose.
20578207 Meta-analysis of gene-disease association. (HuGE Navigator)
20565774 Observational study of genotype prevalence. (HuGE Navigator)
20534879 data indicate that intestinal fatty acid binding protein (FABP2) expression depends on (n-3) fatty acid intake and FABP2 genotypes
20534879 Observational study of gene-disease association. (HuGE Navigator)
20484485 TT genotype in Ala54Thr polymorphism of FABP2 gene in patients with type 2 diabetes increased dietary fatty acid absorption, and this might increase the susceptibility to the effects of dietary lipids.
20484485 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20413122 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20384434 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332099 Observational study of gene-disease association. (HuGE Navigator)
20329566 the association of the Thr54/Ala54 and Thr54/ Thr54 FABP2 genotypes with higher levels of C reactive protein, insulin and HOMA.
20329566 Observational study of gene-disease association. (HuGE Navigator)
20308031 not useful in predicting colorectal cancer risk in populations with high fat intake
20308031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20202768 the Ala54Thr polymorphism of FABP2 was associated with a risk of hearing impairment in middle-aged and elderly people
20202768 Observational study of gene-disease association. (HuGE Navigator)
20080390 genetic association studies [Iran]: FABP2 SNP affects response to eicosapentaenoic acid supplementation in hypertriglyceridemia; more favorable effects on blood lipids/lipoproteins in subjects with Ala54/Thr54 genotype than with Ala54/Ala54 genotype
20080390 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20047744 Meta-analysis of gene-disease association. (HuGE Navigator)
19961041 the polymorphism Ala54Thr of FABP in patients with nonalcoholic fatty liver disease doesn't predict liver histological changes, nor both insulin resistance and serum adipokines variat
19961041 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
19689828 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19689066 FABP2 Thr54Thr genotype might increase the risk of non-alcoholic fatty liver disease.
19689066 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19499240 two FABPs display differences in localization, regulation and developmental pattern.
19491387 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19475463 The fatty acid binding protein 2 (FABP2) gene codes for intestinal FABP,which is a member of a family of small intracellular lipid-binding proteins.
19475463 Observational study of gene-disease association. (HuGE Navigator)
19439328 Limiting dietary saturated fat intake may be particularly important among carriers of the A allele of FABP2.
19384318 The present study shows that the Ala54Thr polymorphism in the FABP2 gene was associated with higher food intake in Japanese women.
19384318 Observational study of gene-disease association. (HuGE Navigator)
19367093 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19324445 Single nucleotide polymorphism may identify Caucasian subjects at risk for obesity but not for type 2 diaetes.
19324445 Observational study of gene-disease association. (HuGE Navigator)
19288030 Results suggest that ALOX5AP, IRAK1, and FABP2 are susceptibility loci for CKD among Japanese individuals with type 2 diabetes mellitus.
19282863 Observational study of gene-disease association. (HuGE Navigator)
19156719 functional FABP2 contributes to multifactorialy regulated body weight.
19156719 Observational study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18824579 investigation of a Canadian multiethnic population demonstrated that FABP2 T54 carriers had significantly higher triglyceride concentrations than noncarriers; no evidence that the T54 variant was associated with insulin resistance or dietary interactions
18701184 Data show that similar weight loss is associated with different changes, depending on the fatty acid-binding protein 2 genotype with both diets.
18701184 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18634911 A functional role of PPARgamma/RXRalpha and Oct-1 in the regulation of the FABP2 gene.
18506375 Data show that genotypes for the 2445G-->A (Ala54Thr) polymorphism of FABP2 was associated (P<0.05) with the prevalence of atherothrombotic cerebral infarction.
18506375 Observational study of gene-disease association. (HuGE Navigator)
18440731 our data suggest a major role of HNF-1alpha in control of FABP2 expression in intestine via a functional HNF-1alpha recognition element within FABP2 promoter region -185 to -165.
18422024 Ala54 Thr polymorphism of the FABP2 gene is associated with insulin sensitivity in pubertal girls born small for gestational age
18422024 Observational study of gene-disease association. (HuGE Navigator)
18282109 Observational study of gene-disease association. (HuGE Navigator)
18280114 Polymorphism Ala54Thr of fatty acid-binding protein did not have an effect on weight loss or clinical outcomes after bariatric surgery.
18280114 Observational study of gene-disease association. (HuGE Navigator)
18201778 The elevated serum I-FABP concentration in patients with ulcerative colitis may indicate ileitis.
18065580 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18065580 Men and women homozygous for FABP2 Thr54 presented a significant opposite profile for plasma oleic acid (18:1), triacylglycerol-rich lipoprotein (TRL) cholesterol, and TRL phospholipids. All Thr/Thr men presented higher 18:1 values than did women.
17992640 Observational study of gene-disease association. (HuGE Navigator)
17992640 Analysis of the three groups (ALA54/THR54, THR54/THR54 and ALA54/ALA54) shows a higher levels of fat mass in Thr54/Thr54 group than Ala54/Ala54). CRP, IL-6, and lipoprotein-a were higher in mutant groupa (ALA54/THR54, THR54/THR54) than in ALA54/ALA54.
17975119 Observational study of gene-disease association. (HuGE Navigator)
17960769 the molecular basis for the variant specific transcriptional regulation of the diabetes type 2-associated FABP2 gene.
17921407 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17921407 We detected an interaction between the Ala54Thr polymorphism and the type of oil consumed that accounted for the variance in insulin resistance
17914506 Observational study of genotype prevalence. (HuGE Navigator)
17907115 Observational study of gene-disease association. (HuGE Navigator)
17907115 A54T polymorphism of the FABP2 gene is associated with cardiovascular disease risk in obese subjects.
17684408 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17633563 Observational study of genotype prevalence. (HuGE Navigator)
17605029 Intestinal L-FABP expression was investigated by immuno-histochemistry, western blot, ELISA and Northern blot analysis
17594477 Observational study of gene-disease association. (HuGE Navigator)
17594477 no association between the Thr54 allele of FABP2 and any of the five selected markers of cardiovascular disease
17512303 Observational study of gene-disease association. (HuGE Navigator)
17512303 findings show a significant increase in postprandial triglyceride levels and a decrease in insulin sensitivity due to T54T only in the presence of the homozygous B genotype at the promoter polymorphism
17447159 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17428383 There were not significant difference I-FABP expression between ductal infiltrating carcinoma and benign tissue in human breast cancer.
17383953 Observational study of gene-disease association. (HuGE Navigator)
17343826 Binding element at position -336/-324 essentially determines the transcriptional activity of promoter and may be important in control of hFABP2 expression by dietary lipids and differentiation.
17310796 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17310796 163G>A (Ala54Thr) polymorphism exerts an influence on effective dose of the valproic acid but not of topiramate.
17292994 Observational study of gene-disease association. (HuGE Navigator)
17292994 Association between the Ala54Thr polymorphism of FABP2 with diabetes, reveals a genetic dosage effect regarding its association with diabetes in Chilean elders.
17212611 Observational study of gene-disease association. (HuGE Navigator)
17211557 Observational study of gene-disease association. (HuGE Navigator)
17211557 It is unlikely that Ala54Thr polymorphism of the FABP2 gene plays a relevant role in obesity and insulin resistance in Chilean ethnic groups.
17209184 Observational study of gene-disease association. (HuGE Navigator)
17143557 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16945373 Thr-54 polymorphism of the FABP2 gene is associated with a 2-3.5-fold increase in cardiovascular risk in dyslipidemic men with diabetes compared to their non-diabetic counterparts
16919542 Observational study of gene-disease association. (HuGE Navigator)
16919542 The odds ratio (adjusted for age and sex) for metabolic syndrome for the individuals carrying the Ala54Thr genotype was 1.240 whereas for those carrying the Thr54Thr genotype, it was 1.812
16908951 Observational study of gene-disease association. (HuGE Navigator)
16908951 FABP 2 may have a role in reducing delta 6 desaturase activity and plasma arachidonic acid in obese children
16809903 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16733910 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16718632 Observational study of gene-disease association. (HuGE Navigator)
16718632 concluded that the T54 allele of fatty acid binding protein 2(FABP2) A54T is associated both with higher body mass index and reduced risk of type 2 diabetes in women
16718625 Observational study of gene-disease association. (HuGE Navigator)
16718625 findings suggest that the functional Fatty acid-binding protein 2 (FABP2) promoter haplotype may contribute to type 2 diabetes in a sex-specific manner
16679929 a blood marker of chemotherapy-induced enterocyte toxocity in rhabdomyosarcoma.
16289894 Observational study of gene-disease association. (HuGE Navigator)
16276364 Observational study of gene-disease association. (HuGE Navigator)
16249461 Observational study of gene-disease association. (HuGE Navigator)
16249461 Evidence that FABP2 confers susceptibility to renal disease in type 2 diabetic patients is presented.
16013194 Observational study of gene-disease association. (HuGE Navigator)
16002819 Observational study of gene-environment interaction. (HuGE Navigator)
15869758 Observational study of gene-disease association. (HuGE Navigator)
15776585 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15764642 Observational study of gene-disease association. (HuGE Navigator)
15620432 Observational study of gene-disease association. (HuGE Navigator)
15620432 Thr54 allele of FABP2 has associations with lower adjusted resting metabolic rate and early onset of obesity in Japanese obese women.
15598690 Observational study of gene-disease association. (HuGE Navigator)
15598690 This study evaluates in Asian-Indians the association between these polymorphisms with metabolic syndrome and dyslipidemia
15572430 Observational study of gene-disease association. (HuGE Navigator)
15572430 Association between the Ala(54)Thr variant in the FABP2 gene and levels of visceral (VAT) and sc (SAAT) abdominal fat in a group of 223 premenopausal African-American (n = 103) and Caucasian (n = 120) women.
15547295 the effects of FABP2 allelic variations may play roles in cardiovascular pathogenesis in the presence of insulin resistance or hypertriglyceridemia
15527447 Observational study of gene-disease association. (HuGE Navigator)
15177133 FABP2 polymorphism plays little if any role for lipid or glucose metabolism.
15159243 Observational study of gene-environment interaction. (HuGE Navigator)
15135268 Observational study of gene-disease association. (HuGE Navigator)
15135251 Observational study of gene-disease association. (HuGE Navigator)
14981227 Observational study of gene-disease association. (HuGE Navigator)
14686962 Observational study of gene-disease association. (HuGE Navigator)
14666368 Observational study of genotype prevalence. (HuGE Navigator)
14650352 Observational study of gene-environment interaction. (HuGE Navigator)
14605999 fatty acid binding protein 2 polymorphism Ala54Thr is not associated with diabetic retinopathy
14563446 besides I-FABP, also L-FABP is a useful plasma marker for the detection of intestinal injury, especially in patients undergoing intestinal surgery
12855223 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12855223 concluded that there is a unique distribution of the FABP2 Ala54Thr polymorphism in the Tongan population which is associated with decreased total and LDL cholesterol
12691171 Clinical trial of gene-environment interaction. (HuGE Navigator)
12370850 genetic variants in the gene appear not to have a major role as modifier genes in familial combined hyperlipidemia
12189904 Observational study of gene-disease association. (HuGE Navigator)
12161503 Observational study of gene-disease association. (HuGE Navigator)
12161503 Unlike type 2 diabetes, type 1 does not interact with the codon 54 polymorphism of the fatty acid binding protein 2 gene.
12079887 Observational study of gene-disease association. (HuGE Navigator)
11866034 Observational study of gene-disease association. (HuGE Navigator)
11866034 lack of association between the Ala54Thr polymorphism of FABP2 gene and obesity and obesity with dyslipidemia in Japanese schoolchildren
11730822 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11707533 Observational study of gene-disease association. (HuGE Navigator)
11699048 Observational study of gene-disease association. (HuGE Navigator)
11555846 Observational study of genotype prevalence, gene-disease association, and gene-environment interaction. (HuGE Navigator)
11423496 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11299043 Observational study of gene-disease association. (HuGE Navigator)
11299043 The A54T polymorphism at the intestinal fatty acid binding protein 2 is associated with insulin resistance in glucose tolerant Caucasians.
11288045 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFN      1 - 70
YNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD             71 - 132
//

Text Mined References (177)

PMID Year Title
27110575 2016 Urinary Intestinal Fatty Acid-Binding Protein Can Distinguish Necrotizing Enterocolitis from Sepsis in Early Stage of the Disease.
26798632 2015 Serologic Intestinal-Fatty Acid Binding Protein in Necrotizing Enterocolitis Diagnosis: A Meta-Analysis.
26703680 2015 The Ala54Thr Polymorphism of the Fatty Acid Binding Protein 2 Gene Modulates HDL Cholesterol in Mexican-Americans with Type 2 Diabetes.
26316042 2015 Role of Fatty Acid-Binding Protein 2 Ala54Thr Genotype on Weight Loss and Cardiovascular Risk Factors after a High-Protein/Low-Carbohydrate versus a Standard Hypocaloric Diet during 9 Months.
26238699 2015 The fatty acid binding protein 2 (FABP2) polymorphism Ala54Thr and obesity in Pakistan: A population based study and a systematic meta-analysis.
26114190 2015 Serum intestinal-fatty acid binding protein as a biomarker for refractory celiac disease.
26019038 Influence of ApoE and FABP2 polymorphisms and environmental factors in the susceptibility to gallstone disease.
25847235 2015 Fatty Acid-binding Proteins 1 and 2 Differentially Modulate the Activation of Peroxisome Proliferator-activated Receptor ? in a Ligand-selective Manner.
25807642 2015 Intestinal fatty acid binding protein (I-FABP) as a promising test for Crohn's disease: a preliminary study.
25793701 2015 Intestinal fatty acid-binding protein as a diagnostic marker for complicated and uncomplicated necrotizing enterocolitis: a prospective cohort study.
25730055 2015 Association of the FABP2 Ala54Thr polymorphism with type 2 diabetes, obesity, and metabolic syndrome: a population-based case-control study and a systematic meta-analysis.
25594612 2015 Human genetics of diabetic nephropathy.
25416956 2014 A proteome-scale map of the human interactome network.
25388378 2014 Association between FABP2 Ala54Thr polymorphisms and type 2 diabetes mellitus risk: a HuGE Review and Meta-Analysis.
25357227 2015 Association of ACE, FABP2 and GST genes polymorphism with essential hypertension risk among a North Indian population.
25324448 2015 I-FABP and L-FABP are early markers for abdominal injury with limited prognostic value for secondary organ failures in the post-traumatic course.
25262933 2014 Polymorphism Ala54Thr of fatty acid-binding protein 2 gene is not associated with stroke risk in Han population of Hunan China.
24956227 2014 Intestinal fatty acid-binding protein: a possible marker for gut maturation.
24690233 2014 A54T polymorphism in the fatty acid binding protein 2 studies in a Saudi population with type 2 diabetes mellitus.
24640155 2013 [Study on association of FABP2 gene Ala54Thr polymorphism with risk of obesity, body fat mass and physical activity].
24340071 2013 Ala54Thr fatty acid-binding protein 2 (FABP2) polymorphism in recurrent depression: associations with fatty acid concentrations and waist circumference.
24100750 2014 Plasma intestinal fatty acid-binding protein levels correlate with morphologic epithelial intestinal damage in a human translational ischemia-reperfusion model.
23911300 2013 Polymorphisms in lipid metabolism related miRNA binding sites and risk of metabolic syndrome.
23817228 2013 Fatty acid-binding protein 2 Ala54Thr genotype is associated with insulin resistance and leptin levels changes after a high monounsaturated fat diet in obese non-diabetic patients.
23468166 2014 Association of angiotensin-converting enzyme (ACE) and fatty acid binding protein 2 (FABP2) genes polymorphism with type 2 diabetes mellitus in Northern India.
23362142 2013 Higher cardiorespiratory fitness attenuates arterial stiffening associated with the Ala54Thr polymorphism in FABP2.
23303383 2013 Single-nucleotide polymorphisms inside microRNA target sites influence the susceptibility to type 2 diabetes.
23072901 2012 Effect of fatty acid-binding protein 2 Ala54Thr genotype on weight loss and cardiovascular risk factors after a high-polyunsaturated fat diet in obese patients.
22838187 2012 FABP2 gene polymorphism and metabolic syndrome in elderly people of croatian descent.
22817827 2013 Effect of Ala54Thr polymorphism of FABP2 on anthropometric and biochemical variables in response to a moderate-fat diet.
22396741 2012 Common variants of the liver fatty acid binding protein gene influence the risk of type 2 diabetes and insulin resistance in Spanish population.
21861348 2011 [FABP2 gene polymorphism and metabolic disorder of lipids in the middle aged and aged population].
21840466 2011 A high-fat diet and the threonine-encoding allele (Thr54) polymorphism of fatty acid-binding protein 2 reduce plasma triglyceride-rich lipoproteins.
21767383 2011 Fatty acid binding proteins (FABPs) in prostate, bladder and kidney cancer cell lines and the use of IL-FABP as survival predictor in patients with renal cell carcinoma.
21355293 2011 [Analysis of the FABP2 gene Ala54Thr polymorphism in non-obese and obese Chinese].
21288588 2011 Polymorphisms in fatty acid binding protein 5 show association with type 2 diabetes.
21079390 2010 Polymorphism Ala54Thr of fatty acid-binding protein 2: Allelic frequencies and influence on cardiovascular risk factors in a multicenter study of Castilla y Leon.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20723947 2011 Metabolic syndrome and ALA54THR polymorphism of fatty acid-binding protein 2 in obese patients.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20621703 2011 Meta-analysis on the effect of the Ala54Thr polymorphism of the fatty acid-binding protein 2 gene on body mass index.
20578207 2010 Association of the fatty acid-binding protein 2 gene Ala54Thr polymorphism with insulin resistance and blood glucose: a meta-analysis in 13451 subjects.
20565774 2010 Population based allele frequencies of disease associated polymorphisms in the Personalized Medicine Research Project.
20534879 2010 Human intestinal fatty acid binding protein 2 expression is associated with fat intake and polymorphisms.
20484485 2010 The Ala54Thr polymorphism of the FABP2 gene influences the postprandial fatty acids in patients with type 2 diabetes.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20413122 2010 Soluble fibre (Plantago ovata husk) reduces plasma low-density lipoprotein (LDL) cholesterol, triglycerides, insulin, oxidised LDL and systolic blood pressure in hypercholesterolaemic patients: A randomised trial.
20384434 2010 Combining genetic markers and clinical risk factors improves the risk assessment of impaired glucose metabolism.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
20329566 2010 Influence of Ala54Thr polymorphism of fatty acid-binding protein 2 on insulin resistance and adipocytokines in patients with diabetes mellitus type 2.
20308031 2010 Functional polymorphisms to modulate luminal lipid exposure and risk of colorectal cancer.
20202768 2010 The Ala54Thr polymorphism in the fatty acid-binding protein 2 (FABP2) gene is associated with hearing impairment: a preliminary report.
20080390 Fatty acid-binding protein-2 genotype influences lipid and lipoprotein response to eicosapentaenoic acid supplementation in hypertriglyceridemic subjects.
20047744 2010 Ala54Thr polymorphism of fatty acid-binding protein 2 gene and fasting blood lipids: a meta-analysis.
19961041 Influence of Ala54Thr polymorphism of fatty acid-binding protein 2 on histological alterations and insulin resistance of non alcoholic fatty liver disease.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19689828 2009 Nutrigenetics: links between genetic background and response to Mediterranean-type diets.
19689066 2009 [Study on the relationship between FABP2 Ala54Thr polymorphism and the risk of non-alcoholic fatty liver diseases].
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19499240 2009 Localization, function and regulation of the two intestinal fatty acid-binding protein types.
19491387 2009 Severe obesity is associated with novel single nucleotide polymorphisms of the ESR1 and PPARgamma locus in Han Chinese.
19475463 2009 Ala54Thr polymorphism of fatty acid binding protein 2, role on insulin resistance and cardiovascular risk factors in presurgical morbid obesity patients.
19439328 2009 Ala54Thr polymorphism of the fatty acid binding protein 2 gene and saturated fat intake in relation to lipid levels and insulin resistance: the Coronary Artery Risk Development in Young Adults (CARDIA) study.
19384318 2009 The Ala54Thr polymorphism in the fatty acid-binding protein 2 gene leads to higher food intake in Japanese women.
19367093 2009 Association study between candidate genes and obesity-related phenotypes using a sample of lumberjacks.
19324445 2009 Thr54 allele of fatty-acid binding protein 2 gene is associated with obesity but not type 2 diabetes mellitus in a Caucasian population.
19288030 2009 Association of genetic variants with chronic kidney disease in Japanese individuals with type 2 diabetes mellitus.
19282863 2009 Association of candidate gene polymorphisms with chronic kidney disease in Japanese individuals with hypertension.
19156719 2009 Association between functional FABP2 promoter haplotypes and body mass index: analyses of 8072 participants of the KORA cohort study.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18824579 2008 Association of the FABP2 T54 variant with plasma triglycerides and insulin resistance in a multiethnic population.
18701184 2008 Influence of Ala54Thr polymorphism of fatty acid-binding protein 2 on weight loss and insulin levels secondary to two hypocaloric diets: a randomized clinical trial.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18634911 2008 Analysis of the transcriptional regulation of the FABP2 promoter haplotypes by PPARgamma/RXRalpha and Oct-1.
18506375 2008 Association of genetic variants with atherothrombotic cerebral infarction in Japanese individuals with metabolic syndrome.
18440731 2008 Transcriptional regulation of the fatty acid binding protein 2 (FABP2) gene by the hepatic nuclear factor 1 alpha (HNF-1alpha).
18422024 2008 Ala54Thr polymorphism of the fatty acid-binding protein 2 gene (intestinal-type FABP) is associated with changes in insulin sensitivity in SGA pubertal girls.
18282109 2008 Adaptations to climate in candidate genes for common metabolic disorders.
18280114 2008 Influence of Ala54Thr polymorphism of fatty acid-binding protein-2 on clinical results of biliopancreatic diversion.
18201778 2008 Intestinal fatty acid binding protein (I-FABP) as a possible biomarker of ileitis in patients with ulcerative colitis.
18065580 2007 Sex-specific association of fatty acid binding protein 2 and microsomal triacylglycerol transfer protein variants with response to dietary lipid changes in the 3-mo Medi-RIVAGE primary intervention study.
17992640 2007 Influence of ALA54THR polymorphism of fatty acid-binding protein 2 on obesity and cardiovascular risk factors.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17960769 2008 Type 2 diabetes-associated fatty acid binding protein 2 promoter haplotypes are differentially regulated by GATA factors.
17921407 2007 Effect of the interaction between the fatty acid binding protein 2 gene Ala54Thr polymorphism and dietary fatty acids on peripheral insulin sensitivity: a cross-sectional study.
17914506 2007 Analysis of HumFABP2 as a polymorphic human genetic marker in the Turkish population.
17907115 2007 Association of the T54 allele of the FABP2 gene with cardiovascular risk factors in obese Mexican subjects.
17684408 2007 Gene-environment interactions and the diabetes epidemic in India.
17633563 2007 [Population study of the Udmurt population: analysis of ten polymorphic DNA loci of the nuclear genome].
17605029 2007 Decreased expression of Intestinal I- and L-FABP levels in rare human genetic lipid malabsorption syndromes.
17594477 2007 Polymorphism of the FABP2 gene: a population frequency analysis and an association study with cardiovascular risk markers in Argentina.
17512303 2007 The association of fatty acid-binding protein 2 A54T polymorphism with postprandial lipemia depends on promoter variability.
17447159 2007 The effects of retinol on postprandial parameters in men with different FABP2 promoter haplotypes.
17428383 2007 [Expression of fatty acid binding protein in human breast cancer tissues].
17383953 2007 [Correlation of FABP2-A54T polymorphism and the metabolic syndrome in Maros County of Romania].
17343826 2007 The human intestinal fatty acid binding protein (hFABP2) gene is regulated by HNF-4alpha.
17310796 2007 [An association between the FABP2 gene polymorphism and efficacy of valproates].
17292994 2007 FABP2 Ala54Thr polymorphism and diabetes in Chilean elders.
17212611 2007 Increased plasma levels of asymmetric dimethylarginine in patients with carotid stenosis: no evidence for the role of the common FABP2 A54T gene polymorphism.
17211557 2006 Lack of association between the fatty acid binding protein 2 (FABP2) polymorphism with obesity and insulin resistance in two aboriginal populations from Chile.
17209184 2007 FABP2 Ala54Thr genotype is associated with glucoregulatory function and lipid oxidation after a high-fat meal in sedentary nondiabetic men and women.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17143557 2007 Association of gene polymorphisms with myocardial infarction in individuals with or without conventional coronary risk factors.
16945373 2007 Codon 54 polymorphism of the fatty acid binding protein (FABP) 2 gene is associated with increased cardiovascular risk in the dyslipidemic diabetic participants of the Veterans Affairs HDL intervention trial (VA-HIT).
16919542 2006 Thr54 allele carriers of the Ala54Thr variant of FABP2 gene have associations with metabolic syndrome and hypertriglyceridemia in urban South Indians.
16908951 2006 Thr-encoding allele homozygosity at codon 54 of FABP 2 gene may be associated with impaired delta 6 desatruase activity and reduced plasma arachidonic acid in obese children.
16809903 2006 Influence of ALA54THR polymorphism of fatty acid binding protein 2 on lifestyle modification response in obese subjects.
16733910 2006 [Effect of polymorphism of human intestinal fatty acid binding protein gene on the therapeutic efficacy of fenofibrate].
16718632 2006 Preliminary evidence of FABP2 A54T polymorphism associated with reduced risk of type 2 diabetes and obesity in women from a German cohort.
16718625 2006 Association between functional FABP2 promoter haplotype and type 2 diabetes.
16679929 2006 Detection of chemotherapy-induced enterocyte toxicity with circulating intestinal fatty acid binding protein.
16289894 2005 The role of FABP2 gene polymorphism in alcoholic cirrhosis.
16276364 2006 Clinical and genetic associations with hypertriglyceridemic waist in a Canadian aboriginal population.
16249461 2005 The fatty acid-binding protein-2 A54T polymorphism is associated with renal disease in patients with type 2 diabetes.
16013194 2005 Genetic variation of the intestinal fatty acid-binding protein 2 gene in carotid atherosclerosis.
16002819 2005 The Ala54Thr polymorphism of the fatty acid-binding protein 2 gene is associated with a change in insulin sensitivity after a change in the type of dietary fat.
15869758 2006 Metabolic syndrome in aboriginal Canadians: prevalence and genetic associations.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15776585 2002 [Genetic polymorphism of pyruvate dehydrogenase kinase 4 (PDK4), paraoxonase 2 (PON2), and fatty acid binding protein 2 (FABP2) in the NIDDM population of Senegal].
15764642 2005 Additive effects of the PPARgamma, APOE, and FABP-2 genes in increasing daylong triglycerides of normolipidemic women to concentrations comparable to those in men.
15620432 2005 Thr54 allele of the FABP2 gene affects resting metabolic rate and visceral obesity.
15598690 2005 Polymorphisms in the fatty acid-binding protein 2 and apolipoprotein C-III genes are associated with the metabolic syndrome and dyslipidemia in a South Indian population.
15572430 2005 Association of the intestinal fatty acid-binding protein Ala54Thr polymorphism and abdominal adipose tissue in African-American and Caucasian women.
15547295 2005 Intestinal fatty acid binding protein and microsomal triglyceride transfer protein polymorphisms in French-Canadian youth.
15527447 2004 The FABP2 gene polymorphism in cerebrovascular disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15177133 2004 The role of the A54T polymorphism of the intestinal fatty acid binding protein for lipid levels, insulin sensitivity and carotid atherosclerosis.
15159243 2004 Postprandial lipemia in subjects with the threonine 54 variant of the fatty acid-binding protein 2 gene is dependent on the type of fat ingested.
15135268 2004 Genetic risk for restenosis after coronary balloon angioplasty.
15135251 2004 Genetic polymorphisms affecting the phenotypic expression of familial hypercholesterolemia.
14981227 2004 Intestinal FABP2 A54T polymorphism: association with insulin resistance and obesity in women.
14686962 2004 The effect of polymorphism in the intestinal fatty acid-binding protein 2 gene on fat metabolism is associated with gender and obesity amongst non-diabetic Japanese-Americans.
14666368 2004 Variation in the FABP2 promoter affects gene expression: implications for prior association studies.
14650352 2003 Physical activity modulates effects of some genetic polymorphisms affecting cardiovascular risk in men aged over 40 years.
14605999 2003 Fatty acid binding protein gene 2 polymorphism is not associated with diabetic retinopathy in Japanese type 2 diabetic patients.
14567680 2003 Consequences of single-site mutations in the intestinal fatty acid binding protein.
14563446 2003 Intestinal-type and liver-type fatty acid-binding protein in the intestine. Tissue distribution and clinical utility.
12899384 1999 The association of Ala54Thr variant of intestinal fatty acid binding protein gene with general and regional adipose tissue depots.
12855223 2003 Obesity, Type II diabetes and the Ala54Thr polymorphism of fatty acid binding protein 2 in the Tongan population.
12809489 2003 Solution structure of human intestinal fatty acid binding protein with a naturally-occurring single amino acid substitution (A54T) that is associated with altered lipid metabolism.
12691171 2002 Genetic polymorphisms and lipoprotein responses to diets.
12634920 2003 Variation in the FABP2 promoter alters transcriptional activity and is associated with body composition and plasma lipid levels.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12377750 2002 Adipocyte fatty acid-binding protein, aP2, alters late atherosclerotic lesion formation in severe hypercholesterolemia.
12370850 2002 Common variants in the lipoprotein lipase gene, but not those in the insulin receptor substrate-1, the beta3-adrenergic receptor, and the intestinal fatty acid binding protein-2 genes, influence the lipid phenotypic expression in familial combined hyperlipidemia.
12189904 2002 Variation in the fatty acid binding protein 2 gene is not associated with markers of metabolic syndrome in patients with coronary heart disease.
12161503 2002 Unlike type 2 diabetes, type 1 does not interact with the codon 54 polymorphism of the fatty acid binding protein 2 gene.
12079887 2002 Detection of a promoter polymorphism in the gene of intestinal fatty acid binding protein (I-FABP).
11730822 2001 Association of the A/T54 polymorphism in the intestinal fatty acid binding protein with variations in plasma lipids in the Framingham Offspring Study.
11707533 2001 Effects of the FABP2 A54T mutation on triglyceride metabolism of viscerally obese men.
11699048 2001 Effects of intestinal fatty acid-binding protein gene Ala54Thr polymorphism and beta3-adrenergic receptor gene Trp64Arg polymorphism on insulin resistance and fasting plasma glucose in young to older Japanese men.
11606480 2001 Role of macrophage-expressed adipocyte fatty acid binding protein in the development of accelerated atherosclerosis in hypercholesterolemic mice.
11555846 2001 FABP2 genotype is associated with insulin sensitivity in older women.
11423496 2001 Association of the Ala54-Thr polymorphism in the intestinal fatty acid-binding protein with 2-h postchallenge insulin levels in the Framingham Offspring Study.
11385507 2001 Lack of macrophage fatty-acid-binding protein aP2 protects mice deficient in apolipoprotein E against atherosclerosis.
11299043 2001 The A54T polymorphism at the intestinal fatty acid binding protein 2 is associated with insulin resistance in glucose tolerant Caucasians.
11288045 2001 Codon 54 polymorphism of the fatty acid binding protein 2 gene is associated with increased fat oxidation and hyperinsulinemia, but not with intestinal fatty acid absorption in Korean men.
10946885 2000 The T 54 allele of the intestinal fatty acid-binding protein 2 is associated with a parental history of stroke.
10856711 2000 The fatty acid transport function of fatty acid-binding proteins.
10070036 1999 Epidermal growth factor regulates fatty acid uptake and metabolism in Caco-2 cells.
9806794 1998 Differential regulation of intestinal and liver fatty acid-binding proteins in human intestinal cell line (Caco-2): role of collagen.
9250601 1997 Molecular mechanism of cellular uptake and intracellular translocation of fatty acids.
9204553 1997 Solution structure of human intestinal fatty acid binding protein: implications for ligand entry and exit.
8954037 1996 Genetic variation of intestinal fatty acid-binding protein associated with variation in body mass in aboriginal Canadians.
8454101 1993 Linkage of chromosomal markers on 4q with a putative gene determining maximal insulin action in Pima Indians.
8401509 1993 The development of sequence-tagged sites for human chromosome 4.
7883976 1995 An amino acid substitution in the human intestinal fatty acid binding protein is associated with increased fatty acid binding, increased fat oxidation, and insulin resistance.
3838313 1985 Human liver fatty acid binding protein. Isolation of a full length cDNA and comparative sequence analyses of orthologous and paralogous proteins.
2824476 1987 The human and rodent intestinal fatty acid binding protein genes. A comparative analysis of their structure, expression, and linkage relationships.
2263509 1990 Trinucleotide repeat polymorphism at the human intestinal fatty acid binding protein gene (FABP2).
2193826 1990 Functions of fatty acid binding proteins.
1740333 1992 Genetic variation at five trimeric and tetrameric tandem repeat loci in four human population groups.