Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.64
PubTator Score 8.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.3e-05
Disease Target Count Z-score Confidence
Xeroderma pigmentosum group F 22 4.117 2.1
Anemia 365 4.063 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.300 4.3e-05

Gene RIF (10)

AA Sequence

MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGN      1 - 70
GYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEP     71 - 140
SKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAF    141 - 210
FTQPR                                                                     211 - 215
//

Text Mined References (19)

PMID Year Title