Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.33
PubTator Score 8.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 4.3e-05
Disease Target Count Z-score Confidence
Anemia 252 4.127 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.300 4.3e-05

Synonym

Accession Q9BTP7 B3KY46 Q8WUJ7 Q96FX6
Symbols C19orf40

Gene

PDB

2LYH   2M9M   2M9N   4BXO   4M6W  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

PMID Text
24003026 Results show that the first HhH motif of FAAP24 is a potential binding site for DNA, which plays a critical role in targeting FANCM-FAAP24 to chromatin.
23999858 These results demonstrate dual roles of FAAP24 in DNA damage response against crosslinking lesions, one through the formation of FANCM/FAAP24 heterodimer and the other via its ssDNA-binding activity required in optimized checkpoint activation.
23932590 Crystal structure of the FANCM-FAAP24 complex.
23333308 FANCM and FAAP24 play multiple, while not fully epistatic, roles in maintaining genomic integrity.
20670894 FANCM/FAAP24 plays a role in ICL-induced checkpoint activation through regulating RPA recruiment at ICL-stalled replication forks.
18995830 DNA damage recognition and remodeling activities of FANCM and FAAP24 cooperate to promote efficient activation of DNA damage checkpoints in Fanconi anemia.
18206976 FAAP24 is dispensable for DNA binding and branch migration activity of FANCM.
18174376 FANCM is an anchor required for recruitment of the FA core complex to chromatin, and the FANCM/FAAP24 interaction is essential for this chromatin-loading activity
17289582 FAAP24 targets FANCM to structures that mimic intermediates formed during the replication/repair of damaged DNA.

AA Sequence

MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGN      1 - 70
GYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEP     71 - 140
SKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAF    141 - 210
FTQPR                                                                     211 - 215
//

Text Mined References (18)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24003026 2013 Structural insights into the functions of the FANCM-FAAP24 complex in DNA repair.
23999858 2013 Structure analysis of FAAP24 reveals single-stranded DNA-binding activity and domain functions in DNA damage response.
23932590 2013 Architecture and DNA recognition elements of the Fanconi anemia FANCM-FAAP24 complex.
23333308 2013 FANCM and FAAP24 maintain genome stability via cooperative as well as unique functions.
20670894 2010 The FANCM/FAAP24 complex is required for the DNA interstrand crosslink-induced checkpoint response.
20347429 2010 MHF1-MHF2, a histone-fold-containing protein complex, participates in the Fanconi anemia pathway via FANCM.
20347428 2010 A histone-fold complex and FANCM form a conserved DNA-remodeling complex to maintain genome stability.
18995830 2008 FANCM and FAAP24 function in ATR-mediated checkpoint signaling independently of the Fanconi anemia core complex.
18206976 2008 The Fanconi anemia protein FANCM can promote branch migration of Holliday junctions and replication forks.
18174376 2008 Cell cycle-dependent chromatin loading of the Fanconi anemia core complex by FANCM/FAAP24.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17289582 2007 Identification of FAAP24, a Fanconi anemia core complex protein that interacts with FANCM.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.