Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.26
PubTator Score 5.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 9.0e-09
glioblastoma 1.200 1.1e-04
medulloblastoma, large-cell 1.100 2.9e-03
osteosarcoma 1.336 3.1e-08
ovarian cancer 1.100 4.8e-04
pediatric high grade glioma 1.100 2.2e-05

Gene RIF (6)

AA Sequence

MEAARRPRLGLSRRRPRPAGGPSGGRPWFLLGGDERERLWAELLRTVSPELILDHEVPSLPAFPGQEPRC      1 - 70
GPEPTEVFTVGPKTFSWTPFPPDLWGPGRSYRLLHGAGGHLESPARSLPQRPAPDPCRAPRVEQQPSVEG     71 - 140
AAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW                                  141 - 180
//

Text Mined References (18)

PMID Year Title