Property Summary

Ligand Count 2
NCBI Gene PubMed Count 7
PubMed Score 5.68
PubTator Score 7.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Renal Cell 124 0.0 0.0
Disease Target Count
Renal Cell Carcinoma 214
Disease Target Count P-value
lung carcinoma 2843 9.2e-20
breast carcinoma 1638 4.5e-04
invasive ductal carcinoma 2951 3.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Renal oncocytoma 22 3.703 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.200 4.5e-04
invasive ductal carcinoma 1.100 3.4e-02
lung carcinoma 1.300 9.2e-20

Gene RIF (5)

AA Sequence

MAPSFTARIQLFLLRALGFLIGLVGRAALVLGGPKFASKTPRPVTEPLLLLSGMQLAKLIRQRKVKCIDV      1 - 70
VQAYINRIKDVNPMINGIVKYRFEEAMKEAHAVDQKLAEKQEDEATLENKWPFLGVPLTVKEAFQLQGMP     71 - 140
NSSGLMNRRDAIAKTDATVVALLKGAGAIPLGITNCSELCMWYESSNKIYGRSNNPYDLQHIVGGSSGGE    141 - 210
GCTLAAACSVIGVGSDIGGSIRMPAFFNGIFGHKPSPGVVPNKGQFPLAVGAQELFLCTGPMCRYAEDLA    211 - 280
PMLKVMAGPGIKRLKLDTKVHLKDLKFYWMEHDGGSFLMSKVDQDLIMTQKKVVVHLETILGASVQHVKL    281 - 350
KKMKYSFQLWIAMMSAKGHDGKEPVKFVDLLGDHGKHVSPLWELIKWCLGLSVYTIPSIGLALLEEKLRY    351 - 420
SNEKYQKFKAVEESLRKELVDMLGDDGVFLYPSHPTVAPKHHVPLTRPFNFAYTGVFSALGLPVTQCPLG    421 - 490
LNAKGLPLGIQVVAGPFNDHLTLAVAQYLEKTFGGWVCPGKF                                491 - 532
//

Text Mined References (9)

PMID Year Title