Property Summary

NCBI Gene PubMed Count 121
PubMed Score 400.21
PubTator Score 479.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.396 8.9e-05
ependymoma -1.300 1.8e-11
glioblastoma -1.100 9.4e-07
pediatric high grade glioma -1.300 1.1e-06
atypical teratoid/rhabdoid tumor -1.100 2.0e-04
ulcerative colitis -1.100 2.8e-05

Gene RIF (125)

PMID Text
26808012 FAAH gene variation was shown to associate with cold pain sensitivity with P129T/rs324420 being the most likely causal variant as it is known to reduce the FAAH enzyme activity.
26806592 Data suggest that subjects who are carriers of minor allele (A) at missense mutation rs324420 in FAAH benefit from increased consumption of oleic and docosahexaenoic acids in dietary treatment of abdominal obesity.
26561012 the FAAH 385C>A polymorphism may have a role in the endocannabinoid-related obesity phenotype
26111155 Studied the mechanism of FAAH for lipid selection to specifically hydrolyze anandamide, examining the role of the dynamic paddle formed at the boundaries of the FAAH catalytic site.
26106535 Cannabis-using FAAH C/C carriers and A carrying controls have reduced white matter integrity compared to control C/C carriers.
26036940 evidence that the genetic variant rs324420 in FAAH is associated with measurable differences in brain FAAH binding as per PET [(11)C]CURB measurement.
25731744 FAAH genetic variation enhances fronto-amygdala function regarding fear regulation in mouse and human.
25558980 Specific FAAH polymorphisms are associated with refractory postoperative nausea and vomiting , opioid-related respiratory depression, and prolonged PACU stay due to opioid adverse effects in white children undergoing tonsillectomy.
25456842 fatty acid amide hydrolase activity decreases in the frontal cortex from patients with Alzheimer's disease
25444073 no significant differences between preeclamptic and normal placenta in terms of CB2 and FAAH expressions and immunoreactivity
24811863 High FAAH expression is associated with drug resistance in non-small cell lung cancer.
24616451 In subcutaneous adipose tissue, DAGL-a mRNA was upregulated and fatty acid amide hydrolase (FAAH) and monoacylglycerol lipase (MAGL) mRNAs were down-regulated in obese subjects, but the diets had no influence.
24593280 In obese humans, FAAH or MGL activity in adipocytes is not affected by diabetes, dyslipidaemia or other markers of metabolic dysfunction.
24445122 Subjects with C385C genotype of the FAAH showed an improvement on insulin and HOMA-R levels with a high polyunsaturated fat hypocaloric diet after weight loss during 3 months
24444427 Single nucleotide polymorphism in the FAAH gene was not associated with IBS pathogenesis.
24407958 our results indicate that the FAAH C385A SNP is one of the most promising candidates for individuals who are at higher risk for alcohol problems.
24223930 FLAT does not serve as a global intracellular AEA carrier
24172113 The findings support an association with CNR1 and FAAH genes and marijuana-related problems among regular marijuana users
24042479 FAAH Pro129/Pro129 homozygotes, reported higher placebo analgesia and more positive affective states immediately and 24 h after placebo administration; no effects on pain report in the absence of placebo were observed.
23926887 It controls intestinal motility through its putative receptors or non-receptor-mediated pathways. Thus, Decreased enteric fatty acid amide hydrolase activity is associated with colonic inertia in slow transit constipation.
23616186 the C385A polymorphism of the fatty acid amide hydrolase gene is not a genetic susceptibility factor for the development of polycystic ovary syndrome.
23556448 Our findings suggest that the FAAH Pro129Thr polymorphism may contribute to methamphetamine dependence in the Malay and Chinese ethnic groups
23372171 Elevated endocannabinoid levels and reduced FAAH activity are associated with ectopic pregnancy and may modulate tubal function, suggesting dysfunctional endocannabinoid action in ectopic implantation.
23347118 Suggest anandamide and FAAH as direct modifiers in signalling mediated activation of Nrf2-HO-1 pathway.
23333123 genetic association study in population in Spain: Data suggest SNP in FAAH (C385A, rs324420) is associated with response of obese subjects to reducing diet which is high in monounsaturated fats; weight loss is higher in subjects with C385C genotype.
23211960 Mapping human brain fatty acid amide hydrolase activity with PET.
23122699 The differential expression of NAPE-PLD and FAAH suggests that Anandamide could play an important role in the pathophysiology of preeclampsia.
22832737 our data suggest that FAAH has an important role in PTSD through modulation of aversive memories and point to both a novel therapeutic target and a possible risk marker.
22827915 FAAH expression increase steadily after infancy, peaking in adulthood.
22826533 genetic association studies in a population in Spain: Data suggest that an SNP in FAAH (rs324420) is not associated with response/resistance or remission/no remission with citalopram treatment in patients with major depressive disorder.
22776995 FAAH A carriers, compared to C/C carriers, exhibited increased startle potentiation and emotional responsiveness towards unpleasant picture stimuli, and reduced startle inhibition indicating reduced emotional reactivity in response to pleasant pictures
22701012 Cannabinoid receptors and endocannabinoid modulating enzymes were localized in fallopian tube epithelium by immunohistochemistry and showed reduced CB1 and FAAH expression in ectopic pregnancy
22609216 There is a lack of association of the FAAH genotypes with metabolic syndrome prevalence.
22442717 Peripheral effects of FAAH deficiency on fuel and energy homeostasis: role of dysregulated lysine acetylation.
22068813 The impact of AA/CA genotype of rs324420 on the level of weight reduction or associated phenotypes in obese children and adolescents, was examined.
22035053 Subcutaneous adipose tissue FAAH expression is higher in abdominal fat than in gluteal fat. Caloric restriction alters gluteal adipose tissue FAAH expression; caloric restriction plus aerobic exercise alters abdominal adipose tissue FAAH expression.
21930339 Messenger RNA and protein for FAAH was expressed in the mucosa of human bladder.
21519771 The novel finding of this study is the association of the mutant type group A358C and A358A of FAAH with a better cardiovascular profile (triglyceride, glucose, interleukine 6 and HOMA levels) than wild type group
21477106 CNR1 and FAAH are associated with altered gastric functions or satiation that may predispose to obesity.
21442624 These results provide evidence that CB(1)R blockade through the recovery of FAAH 1 expression may be a potential anti-diabetic therapy for the treatment of diabetic retinopathy.
21118518 One interval in the FAAH promoter and three intervals in the MGLL gene were associated with high BMI.
21037510 Observational study of gene-disease association. (HuGE Navigator)
20976246 Observational study of gene-disease association. (HuGE Navigator)
20870184 The allele A358 of fatty acid amide hydrolase was associated with a better initial percentage of excess weight loss 9 and 12 months after biliopancreatic diversion.
20808855 Tumour epithelial FAAH-IR is associated with prostate cancer severity and outcome at mid-range, but not high, CB(1)IR scores.
20716455 The A allele at rs324420 in the fatty-acid amide hydrolase gene was associated with larger improvements in glucose, total cholesterol, low-density lipoprotein cholesterol, body mass, and waist circumference after a dietary intervention.
20716455 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20631561 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20369362 During the menstrual cycle, FAAH immunoreactivity in the endometrium was highest in the mid-proliferative gland and mid-secretory stroma.
20189896 In patients with morbid obesity, the C358A polymorphism of FAAH was not associated with anthropometric parameters, biochemical markers or adipocytokine levels.
20189896 Observational study of gene-disease association. (HuGE Navigator)
20102775 The allele A358 of fatty acid amide hydrolase was associated with a lack of improvement on glucose insulin, HOMA, and leptin levels after weight loss.
20099163 FAAH expression and hydrolysis activity in the colon decrease in children with slow transit constipation.
20098695 Observational study of gene-disease association. (HuGE Navigator)
20080186 These findings, although preliminary, suggest that the FAAH cDNA gene variants may contribute to the susceptibility to mood disorders
20080186 Observational study of gene-disease association. (HuGE Navigator)
20065978 The novel finding is the association of the mutant type group A358C of FAAH with lower glucose, insulin and insulin sensitivity levels than of the wild-type group with higher visfatin levels.
20065978 Observational study of gene-disease association. (HuGE Navigator)
20056290 There is an association of the mutant type group A358C and A358A of FAAH with a worse cardiovascular profile (weight, body mass index, waist circumference, insulin,TNF-alpha and adiponectin levels) than wild type group.
20056290 Observational study of gene-disease association. (HuGE Navigator)
20054193 results in 5,109 subjects suggest that fatty acid amide hydrolase(FAAH) Pro129Thr polymorphism may modestly contribute to class III adult obesity in the French population
20044928 The combined analysis of all 603 obesity families supported the idea of an association of two SNPs in FAAH (rs324420 and rs2295632) with early onset extreme obesity
20044928 Observational study of gene-disease association. (HuGE Navigator)
20015515 The levels of the CB1 receptors and the fatty acid amide hydrolase were significantly lower in the ventral striatum of CA compared to the control group.
20010914 Observational study of gene-disease association. (HuGE Navigator)
20010552 The underlying mechanism of these genetic effects may be enhanced neural response in reward areas of the brain in carriers of the CNR1 G allele and FAAH C/C genotype in response to marijuana cues.
20010552 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19958092 Genetic variability in FAAH is associated with dyslipidemia, independent of insulin response.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19890266 Individuals with single nucleotide gene polymorphisms at rs3766246 and rs2295633 in the fatty-acid hydrolase gene have significantly higher arousal ratings following amphetatime administration.
19890266 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19859057 Observational study of gene-disease association. (HuGE Navigator)
19801960 Observational study of gene-disease association. (HuGE Navigator)
19659925 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19419760 Very low or absent FAAH and high CB1 levels correspond with spontaneous miscarriage.
19193342 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19165169 There is no evidence for an association of common variants in the CNR1 and FAAH genes with measures of adiposity.
19165169 Observational study of gene-disease association. (HuGE Navigator)
19103437 The C385A carriers of Fatty acid amide hydrolase showed decreased correlation between amygdala reactivity and trait anxiety but increased correlation between ventral striatal reactivity and delay discounting, an index of impulsivity.
19103437 Observational study of gene-disease association. (HuGE Navigator)
19095868 Biochemical and biological properties of 4-(3-phenyl-[1,2,4] thiadiazol-5-yl)-piperazine-1-carboxylic acid phenylamide, a mechanism-based inhibitor of fatty acid amide hydrolase.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19053981 Observational study of gene-disease association. (HuGE Navigator)
19014633 Observational study of gene-disease association. (HuGE Navigator)
19002671 Observational study of gene-disease association. (HuGE Navigator)
18819056 We were unable to find robust evidence of an association of the Pro129Thr variant of FAAH with severe obesity
18819056 Observational study of gene-disease association. (HuGE Navigator)
18805581 FAAH appears to be over expressed in trophoblasts that have invaded the decidua, as well as in large decidual stromal cells in many cases of recurrent miscarriage
18705688 The CNR1 SNP displayed a significant abstinence x genotype interaction on withdrawal, as well as a main effect on overall levels of craving, while the FAAH SNP displayed a significant abstinence x genotype interaction on craving.
18705688 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18566995 fatty acid amide hydrolase is potentially involved in prostate tumorigenesis.
18497731 An FAAH defective gene variant results in lower BP in young males, but this effect is lost in older obese hypertensive patients
18497731 Observational study of gene-disease association. (HuGE Navigator)
18493729 Observational study of gene-disease association. (HuGE Navigator)
18295974 This study found significant over-representations of the FAAH 385 A allele in overweight/obese subjects and presents new data in binge eating disorder (BED) patients that the 385 mutation is not significantly associated with BED-related obesity.
18295974 Observational study of gene-disease association. (HuGE Navigator)
18068305 faah is induced in beta-amyloid plaque-associated microglia and astroglia, respectively, in Down's syndrome
17991615 Observational study of genetic testing. (HuGE Navigator)
17962356 Observational study of gene-disease association. (HuGE Navigator)
17962356 FAAH genotype was associated with symptom phenotype and faster colonic transit in functional gastrointestinal disorders.
17712725 The endocannabinoid system is activated in obese visceral adipose tissue as shown by decreased FAAH, Cb1, and adiponectin expression.
17621164 Observational study of gene-disease association. (HuGE Navigator)
17621164 not associated with susceptibility to alcoholism in a Japanese population.
17553686 finding reported in this study is that lymphocytes of Huntington's disease patients show a dramatic decrease in FAAH activity
17449448 Observational study of gene-disease association. (HuGE Navigator)
17290447 Observational study of gene-disease association. (HuGE Navigator)
17290447 The relationship between the FAAH A/A genotype and risk for drug dependence in this study was drug class specific, suggesting it is not part of a more general drug abuse effect
17216208 Observational study of gene-disease association. (HuGE Navigator)
17216208 study was unable to find robust evidence of an association of the Pro129Thr FAAH variant with overweight, obesity, and any related quantitative traits among the examined whites
17065342 FAAH gene expression was negatively correlated with visceral fat mass and circulating 2-arachidonylglycerol.
16972078 Observational study of gene-disease association. (HuGE Navigator)
16972078 P129T mutation is the only common mutation in the FAAH gene and is significantly associated with addictive traits
15809662 Observational study of gene-disease association. (HuGE Navigator)
15721218 Observational study of gene-disease association. (HuGE Navigator)
15254019 The natural 385A SNP in the human FAAH gene produces a mutant enzyme with reduced cellular stability, thus fortifying a potential link between functional abnormalities in the endocannabinoid system and drug abuse and dependence.
15219977 This review discusses the participation of anandamide (AEA) in hormone-cytokine networks that are essential for human reproduction and the key role played by anandamide hydrolase (FAAH) in regulating the activity of AEA.
14657172 In hippocampus and entorhinal cortex of Alzheimer's disease patients both fatty acid amide hydrolase and cannabinoid CB2 receptors are abundantly and selectively expressed in neuritic plaque-associated astrocytes and microglia
12799380 fatty acid amide hydrolase (FAAH) promoter is activated by progesterone in human T lymphocytes through the transcription factor Ikaros
12556536 Leptin actives the promoter of this enzyme in T cells through STAT3.
12153574 dendritic cells were also found to express measurable amounts of CB1 and CB2 receptors and of FAAH. Cell maturation did not consistently modify the expression of these proteins
12060782 missense mutation associcated with problem drug use
12008024 Fatty acid amide hydrolase in human central nervous system is found in both neuronal and glial elements and shows a significant overlap with central cannabinoid receptors.
11818522 Low levels are associated with failure to achieve an ongoing pregnancy after IVF and embryo transfer.

AA Sequence

MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQRFRLQNPDLD      1 - 70
SEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLADCETQLSQAPRQGLLYGVPVS     71 - 140
LKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKS    141 - 210
SKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSV    211 - 280
GPMARDVESLALCLRALLCEDMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETK    281 - 350
QSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF    351 - 420
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGA    421 - 490
VSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEEL    491 - 560
CLRFMREVERLMTPEKQSS                                                       561 - 579
//

Text Mined References (124)

PMID Year Title
26808012 2016 Effect of endocannabinoid degradation on pain: role of FAAH polymorphisms in experimental and postoperative pain in women treated for breast cancer.
26806592 2016 Interactions between dietary oil treatments and genetic variants modulate fatty acid ethanolamides in plasma and body weight composition.
26561012 2015 Circulating Endocannabinoids and the Polymorphism 385C>A in Fatty Acid Amide Hydrolase (FAAH) Gene May Identify the Obesity Phenotype Related to Cardiometabolic Risk: A Study Conducted in a Brazilian Population of Complex Interethnic Admixture.
26111155 2015 Keys to Lipid Selection in Fatty Acid Amide Hydrolase Catalysis: Structural Flexibility, Gating Residues and Multiple Binding Pockets.
26106535 2015 Poorer frontolimbic white matter integrity is associated with chronic cannabis use, FAAH genotype, and increased depressive and apathy symptoms in adolescents and young adults.
26036940 2015 The fatty acid amide hydrolase C385A variant affects brain binding of the positron emission tomography tracer [11C]CURB.
25731744 2015 FAAH genetic variation enhances fronto-amygdala function in mouse and human.
25558980 2015 Novel associations between FAAH genetic variants and postoperative central opioid-related adverse effects.
25456842 2014 Normal aging in rats and pathological aging in human Alzheimer's disease decrease FAAH activity: modulation by cannabinoid agonists.
25444073 2014 Increased placental expression of cannabinoid receptor 1 in preeclampsia: an observational study.
25416956 2014 A proteome-scale map of the human interactome network.
24811863 2014 FAAH inhibition enhances anandamide mediated anti-tumorigenic effects in non-small cell lung cancer by downregulating the EGF/EGFR pathway.
24616451 2014 Influence of dietary fat intake on the endocannabinoid system in lean and obese subjects.
24593280 2014 The effects of obesity, diabetes and metabolic syndrome on the hydrolytic enzymes of the endocannabinoid system in animal and human adipocytes.
24445122 2013 Effects of C358A polymorphism of the endocannabinoid degrading enzyme fatty acid amide hydrolase (FAAH) on weight loss, adipocytokines levels, and insulin resistance after a high polyunsaturated fat diet in obese patients.
24444427 2014 Association of cannabinoid type 1 receptor and fatty acid amide hydrolase genetic polymorphisms in Chinese patients with irritable bowel syndrome.
24407958 2014 Risky alcohol consumption in young people is associated with the fatty acid amide hydrolase gene polymorphism C385A and affective rating of drug pictures.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223930 2013 Role of FAAH-like anandamide transporter in anandamide inactivation.
24172113 2013 Impulsivity, variation in the cannabinoid receptor (CNR1) and fatty acid amide hydrolase (FAAH) genes, and marijuana-related problems.
24042479 2014 FAAH selectively influences placebo effects.
23926887 2014 Decreased enteric fatty acid amide hydrolase activity is associated with colonic inertia in slow transit constipation.
23616186 2013 Lack of association between C385A functional polymorphism of the fatty acid amide hydrolase gene and polycystic ovary syndrome.
23556448 2013 Association of a functional FAAH polymorphism with methamphetamine-induced symptoms and dependence in a Malaysian population.
23372171 2013 Elevated anandamide and related N-acylethanolamine levels occur in the peripheral blood of women with ectopic pregnancy and are mirrored by changes in peripheral fatty acid amide hydrolase activity.
23347118 2013 Inhibition of fatty acid amide hydrolase activates Nrf2 signalling and induces heme oxygenase 1 transcription in breast cancer cells.
23333123 Genetic variation in the endocannabinoid degrading enzyme fatty acid amide hydrolase (FAAH) and their influence on weight loss and insulin resistance under a high monounsaturated fat hypocaloric diet.
23211960 2013 Mapping human brain fatty acid amide hydrolase activity with PET.
23122699 2013 Differential expression of endocannabinoid system in normal and preeclamptic placentas: effects on nitric oxide synthesis.
22832737 2012 Fatty-acid amide hydrolase polymorphisms and post-traumatic stress disorder after penetrating brain injury.
22827915 2012 Developmental trajectory of the endocannabinoid system in human dorsolateral prefrontal cortex.
22826533 2012 Genetic variability in the endocannabinoid system and 12-week clinical response to citalopram treatment: the role of the CNR1, CNR2 and FAAH genes.
22776995 2012 A polymorphism in the gene of the endocannabinoid-degrading enzyme FAAH (FAAH C385A) is associated with emotional-motivational reactivity.
22701012 2012 Ectopic pregnancy is associated with high anandamide levels and aberrant expression of FAAH and CB1 in fallopian tubes.
22609216 Relationship among metabolic syndrome, C358A polymorphism of the endocannabinoid degrading enzyme fatty acid amide hydrolase (FAAH) and insulin resistance.
22442717 2012 Peripheral effects of FAAH deficiency on fuel and energy homeostasis: role of dysregulated lysine acetylation.
22068813 2012 The fatty acid amide hydrolase (FAAH) gene variant rs324420 AA/AC is not associated with weight loss in a 1-year lifestyle intervention for obese children and adolescents.
22035053 2011 Adipose tissue endocannabinoid system gene expression: depot differences and effects of diet and exercise.
21930339 2012 Expression of fatty acid amide hydrolase (FAAH) in human, mouse, and rat urinary bladder and effects of FAAH inhibition on bladder function in awake rats.
21519771 Relation of C358A polymorphism of the endocannabinoid degrading enzyme fatty acid amide hydrolase (FAAH) with obesity and insulin resistance.
21477106 2011 Association of genetic variation in cannabinoid mechanisms and gastric motor functions and satiation in overweight and obesity.
21442624 2012 Hyperglycemia induces apoptosis via CB1 activation through the decrease of FAAH 1 in retinal pigment epithelial cells.
21118518 2010 Population sequencing of two endocannabinoid metabolic genes identifies rare and common regulatory variants associated with extreme obesity and metabolite level.
21037510 2011 Association of somatoform disorder symptoms with genetic variants potentially involved in the modulation of nociception.
20976246 2010 A covering method for detecting genetic associations between rare variants and common phenotypes.
20870184 Effects of C358A missense polymorphism of the endocannabinoid degrading enzyme fatty acid amide hydrolase on weight loss and cardiovascular risk factors 1 year after biliopancreatic diversion surgery.
20808855 2010 Fatty acid amide hydrolase in prostate cancer: association with disease severity and outcome, CB1 receptor expression and regulation by IL-4.
20716455 2011 Effects of C358A missense polymorphism of the endocannabinoid degrading enzyme fatty acid amide hydrolase on weight loss after a hypocaloric diet.
20631561 2010 Endocannabinoid Pro129Thr FAAH functional polymorphism but not 1359G/A CNR1 polymorphism is associated with antipsychotic-induced weight gain.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20369362 2010 Histomorphometric evaluation of cannabinoid receptor and anandamide modulating enzyme expression in the human endometrium through the menstrual cycle.
20189896 2010 [C358A polymorphism of the endocannabinoid degrading enzyme fatty acid amide hydrolase (FAAH) and adipocytokine levels in the morbidly obese].
20102775 2010 Effects of C358A missense polymorphism of the degrading enzyme fatty acid amide hydrolase on weight loss, adipocytokines, and insulin resistance after 2 hypocaloric diets.
20099163 2010 [Expression and activity of fatty acid amide hydrolase in the colon in children with slow transit constipation].
20098695 2010 Biomarkers of endocannabinoid system activation in severe obesity.
20080186 2010 Investigation of CNR1 and FAAH endocannabinoid gene polymorphisms in bipolar disorder and major depression.
20065978 2010 C358A missense polymorphism of the endocannabinoid-degrading enzyme fatty acid amide hydrolase (FAAH) and visfatin levels in obese females.
20056290 2010 C358A missense polymorphism of the endocannabinoid degrading enzyme fatty acid amide hydrolase (FAAH) and insulin resistance in patients with diabetes mellitus type 2.
20054193 2008 Evaluating the association of FAAH common gene variation with childhood, adult severe obesity and type 2 diabetes in the French population.
20044928 2010 Mutation screen and association studies for the fatty acid amide hydrolase (FAAH) gene and early onset and adult obesity.
20015515 2010 Selective alterations of the CB1 receptors and the fatty acid amide hydrolase in the ventral striatum of alcoholics and suicides.
20010914 2010 Association of polymorphisms of the cannabinoid receptor (CNR1) and fatty acid amide hydrolase (FAAH) genes with heroin addiction: impact of long repeats of CNR1.
20010552 2010 Individual and additive effects of the CNR1 and FAAH genes on brain response to marijuana cues.
19958092 2009 Obesity-related dyslipidemia associated with FAAH, independent of insulin response, in multigenerational families of Northern European descent.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19890266 2010 More aroused, less fatigued: fatty acid amide hydrolase gene polymorphisms influence acute response to amphetamine.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19859057 2009 Genetic variation in the FAAH gene and metabolic syndrome-related phenotypes.
19801960 2009 Lack of association between polymorphisms in cannabinoid receptor gene (CNR1) and fatty acid amide hydroxylase gene (FAAH) and eating disorders in a preliminary study.
19659925 2009 Association of CNR1 and FAAH endocannabinoid gene polymorphisms with anorexia nervosa and bulimia nervosa: evidence for synergistic effects.
19419760 2009 Endocannabinoid system in first trimester placenta: low FAAH and high CB1 expression characterize spontaneous miscarriage.
19193342 2008 Multiple genetic factors in olanzapine-induced weight gain in schizophrenia patients: a cohort study.
19165169 2009 Variants in the CNR1 and the FAAH genes and adiposity traits in the community.
19103437 2009 Divergent effects of genetic variation in endocannabinoid signaling on human threat- and reward-related brain function.
19095868 2009 Biochemical and biological properties of 4-(3-phenyl-[1,2,4] thiadiazol-5-yl)-piperazine-1-carboxylic acid phenylamide, a mechanism-based inhibitor of fatty acid amide hydrolase.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19053981 2009 The role of fatty acid hydrolase gene variants in inflammatory bowel disease.
19014633 2008 Lack of association of genetic variants in genes of the endocannabinoid system with anorexia nervosa.
19002671 2009 Intermediate cannabis dependence phenotypes and the FAAH C385A variant: an exploratory analysis.
18819056 2008 The fatty acid amide hydrolase (FAAH) Pro129Thr polymorphism is not associated with severe obesity in Greek subjects.
18805581 2008 Nuclear localisation of the endocannabinoid metabolizing enzyme fatty acid amide hydrolase (FAAH) in invasive trophoblasts and an association with recurrent miscarriage.
18705688 2008 Marijuana withdrawal and craving: influence of the cannabinoid receptor 1 (CNR1) and fatty acid amide hydrolase (FAAH) genes.
18566995 2008 Expression and function of fatty acid amide hydrolase in prostate cancer.
18497731 2008 A human fatty acid amide hydrolase (FAAH) functional gene variant is associated with lower blood pressure in young males.
18493729 2008 Targeting endocannabinoid degradation protects against experimental colitis in mice: involvement of CB1 and CB2 receptors.
18295974 2008 The cDNA 385C to A missense polymorphism of the endocannabinoid degrading enzyme fatty acid amide hydrolase (FAAH) is associated with overweight/obesity but not with binge eating disorder in overweight/obese women.
18068305 2008 Glial expression of cannabinoid CB(2) receptors and fatty acid amide hydrolase are beta amyloid-linked events in Down's syndrome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17991615 2007 Rapid screening for potentially relevant polymorphisms in the human fatty acid amide hydrolase gene using Pyrosequencing.
17962356 2008 Genetic variation in endocannabinoid metabolism, gastrointestinal motility, and sensation.
17712725 2007 Immune-mediated activation of the endocannabinoid system in visceral adipose tissue in obesity.
17621164 2007 Association study between alcoholism and endocannabinoid metabolic enzyme genes encoding fatty acid amide hydrolase and monoglyceride lipase in a Japanese population.
17553686 2007 Severe deficiency of the fatty acid amide hydrolase (FAAH) activity segregates with the Huntington's disease mutation in peripheral lymphocytes.
17449448 2007 Association in alcoholic patients between psychopathic traits and the additive effect of allelic forms of the CNR1 and FAAH endocannabinoid genes, and the 3' region of the DRD2 gene.
17290447 2007 The fatty acid amide hydrolase C385A (P129T) missense variant in cannabis users: studies of drug use and dependence in Caucasians.
17216208 2007 The functional Pro129Thr variant of the FAAH gene is not associated with various fat accumulation phenotypes in a population-based cohort of 5,801 whites.
17065342 2006 Dysregulation of the peripheral and adipose tissue endocannabinoid system in human abdominal obesity.
17015445 2006 A second fatty acid amide hydrolase with variable distribution among placental mammals.
16972078 2006 The fatty acid amide hydrolase 385 A/A (P129T) variant: haplotype analysis of an ancient missense mutation and validation of risk for drug addiction.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15809662 2005 Overweight and obesity associated with a missense polymorphism in fatty acid amide hydrolase (FAAH).
15721218 2005 A nonsynonymous polymorphism in the human fatty acid amide hydrolase gene did not associate with either methamphetamine dependence or schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254019 2004 Reduced cellular expression and activity of the P129T mutant of human fatty acid amide hydrolase: evidence for a link between defects in the endocannabinoid system and problem drug use.
15219977 2004 Anandamide hydrolase: a guardian angel of human reproduction?
14657172 2003 Cannabinoid CB2 receptors and fatty acid amide hydrolase are selectively overexpressed in neuritic plaque-associated glia in Alzheimer's disease brains.
12799380 2003 Progesterone activates fatty acid amide hydrolase (FAAH) promoter in human T lymphocytes through the transcription factor Ikaros. Evidence for a synergistic effect of leptin.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12556536 2003 Leptin activates the anandamide hydrolase promoter in human T lymphocytes through STAT3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12153574 2002 Presence and regulation of the endocannabinoid system in human dendritic cells.
12060782 2002 A missense mutation in human fatty acid amide hydrolase associated with problem drug use.
11390466 2001 Progesterone up-regulates anandamide hydrolase in human lymphocytes: role of cytokines and implications for fertility.
11352748 2001 Characterization and manipulation of the acyl chain selectivity of fatty acid amide hydrolase.
10806398 2000 Down-regulation of anandamide hydrolase in mouse uterus by sex hormones.
10788462 2000 Anandamide uptake by human endothelial cells and its regulation by nitric oxide.
10431820 1999 An acid amidase hydrolyzing anandamide as an endogenous ligand for cannabinoid receptors.
10036136 1999 A sensitive and specific radiochromatographic assay of fatty acid amide hydrolase activity.
9878243 1998 Conserved chromosomal location and genomic structure of human and mouse fatty-acid amide hydrolase genes and evaluation of clasper as a candidate neurological mutation.
9871570 1998 An endogenous sleep-inducing compound is a novel competitive inhibitor of fatty acid amide hydrolase.
9822713 1998 Anandamide hydrolysis by human cells in culture and brain.
9790682 1998 Comparative characterization of a wild type and transmembrane domain-deleted fatty acid amide hydrolase: identification of the transmembrane domain as a site for oligomerization.
9122178 1997 Molecular characterization of human and mouse fatty acid amide hydrolases.