Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 3.0e-11

AA Sequence

MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRAL      1 - 70
VSIIKELEPKLKSVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRSGDLSQNRKEQAERFDTALCV     71 - 140
LGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIELSSEHGFLTVGCREGKVFAASTVPMTPLWVS    141 - 210
PQLHRVGIFLDVGMRSIAFYNVSDGCHINTFIEIPVCEPWRPFFAHKRGSQDDQSILSICSVINPSTASA    211 - 280
PVSSEGK                                                                   281 - 287
//

Text Mined References (2)

PMID Year Title