Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 286 3.03413116833517E-11

AA Sequence

MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRAL      1 - 70
VSIIKELEPKLKSVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRSGDLSQNRKEQAERFDTALCV     71 - 140
LGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIELSSEHGFLTVGCREGKVFAASTVPMTPLWVS    141 - 210
PQLHRVGIFLDVGMRSIAFYNVSDGCHINTFIEIPVCEPWRPFFAHKRGSQDDQSILSICSVINPSTASA    211 - 280
PVSSEGK                                                                   281 - 287
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.