Property Summary

NCBI Gene PubMed Count 20
PubMed Score 17.16
PubTator Score 23.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (7)

AA Sequence

MAAAAAGLGGGGAGPGPEAGDFLARYRLVSNKLKKRFLRKPNVAEAGEQFGQLGRELRAQECLPYAAWCQ      1 - 70
LAVARCQQALFHGPGEALALTEAARLFLRQERDARQRLVCPAAYGEPLQAAASALGAAVRLHLELGQPAA     71 - 140
AAALCLELAAALRDLGQPAAAAGHFQRAAQLQLPQLPLAALQALGEAASCQLLARDYTGALAVFTRMQRL    141 - 210
AREHGSHPVQSLPPPPPPAPQPGPGATPALPAALLPPNSGSAAPSPAALGAFSDVLVRCEVSRVLLLLLL    211 - 280
QPPPAKLLPEHAQTLEKYSWEAFDSHGQESSGQLPEELFLLLQSLVMATHEKDTEAIKSLQVEMWPLLTA    281 - 350
EQNHLLHLVLQETISPSGQGV                                                     351 - 371
//

Text Mined References (26)

PMID Year Title