Property Summary

NCBI Gene PubMed Count 662
Grant Count 1,291
R01 Count 506
Funding $376,591,928.53
PubMed Score 5471.92
PubTator Score 5232.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (58)

Disease Z-score Confidence
Brain disease 83 8.153 4.0
Toxic encephalopathy 131 5.329 2.7
Dementia 129 5.324 2.7
Alzheimer's disease 644 5.103 2.6
Neuroblastoma 78 3.751 1.9
Amyloidosis 68 3.703 1.9
Cortical blindness 15 3.457 1.7
Amyotrophic Lateral Sclerosis 431
Breast cancer 3,094
Creutzfeldt-Jakob disease 19 2.0
Down syndrome 548
Duchenne muscular dystrophy 602
Fatal Familial Insomnia 5
Gerstmann-Straussler-Scheinker Disease 1
HUNTINGTON DISEASE-LIKE 1 1
Hepatolenticular Degeneration 24
IGA Glomerulonephritis 454
Multiple myeloma 1,327
Myoclonic Epilepsies, Progressive 12
Necrosis 51
Neoplasm Metastasis 138
Neoplasms, Experimental 33
Pick disease 1,893
Prion Diseases 1
Prion disease 10 5.0
Prostatic Neoplasms 471
Rheumatoid Arthritis 1,160
SPONGIFORM ENCEPHALOPATHY WITH NEUROPSYC... 1 
Scrapie 15
Stomach Neoplasms 282
Wilson disease 16 5.0
active Crohn's disease 918
acute quadriplegic myopathy 1,157
adult high grade glioma 2,148
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
chronic lymphosyte leukemia 232
colon cancer 1,475
cystic fibrosis 1,665
dermatomyositis 933
fascioscapulohumeral muscular dystrophy 100
glioblastoma 5,572
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
primitive neuroectodermal tumor 3,031
sonic hedgehog group medulloblastoma 1,482
ulcerative colitis 2,087

Expression

Synonym

Accession F7VJQ1
Symbols CJD
GSS
PrP
ASCR
KURU
PRIP
PrPc
CD230
AltPrP
p27-30
PrP27-30
PrP33-35C

Gene

Gene RIF (608)

PMID Text
26946358 The results suggest a role of PrP(C) in proteostasis, dysfunctions of which may be involved in the pathogenesis of neurodegenerative diseases such as TSE and Alzheimer's Disease.
26778001 Overall, these results suggest that PrP(c) contribute the breast cancer invasion and migration via MMP-9.
26710111 PrP(C) is highly enriched on exosomes from SH-SY5Y cells and that exosomes bind amyloid beta via PrP(C).
26683373 these results show that multiple gene irregularity in BxPC-3 cells is responsible for the formation of pro-PrP, and binding of pro-PrP to filamin A contributes to enhanced tumor cell motility.
26667279 Genetic coupling between Prnp and glutamate receptor 5 is responsible for synapse loss in Alzheimer's disease transgenic mouse model.
26528810 PrP-Abeta oligomers binding might be the underlying mechanism of the prion diseases and Alzheimer's disease. [review]
26368533 The decrease in FK-derived PrPSc levels was mediated, at least in part, by the phosphatidylinositol 3-kinase/MEK signalling pathway.
26323476 Effects such as the stabilization of the native alpha-fold, dictating the efficiency of the alpha-cleavage, attenuating the fibrillation propensity and yielding the most benign amyloids suggest that the charge design ensures PrPC functions.
26268531 PRNP codon 129 polymorphism determines incubation time for iatrogenic Creutzfeldt-Jakob disease.
26159734 We propose that PrP modulates beta1 integrin adhesion and migration of monocytes through RhoA-induced actin remodeling mediated by cofilin, and through the regulation of ERM-mediated membrane-cytoskeleton linkage.
More...

AA Sequence

MEHWGQPIPGAGQPWRQPLPTSGRWWLGAASWWWLGAASWWWLGAAPWWWLGTASWWWLGSRRWHPQSVE      1 - 70
QAE                                                                        71 - 73
//

Text Mined References (661)

PMID Year Title
26946358 2016 The prion protein selectively binds to and modulates the content of purinergic receptor P2X4R.
26778001 2016 Cellular prion protein regulates invasion and migration of breast cancer cells through MMP-9 activity.
26710111 2016 Exosomal cellular prion protein drives fibrillization of amyloid beta and counteracts amyloid beta-mediated neurotoxicity.
26683373 2016 Glycosylphosphatidylinositol Anchor Modification Machinery Deficiency Is Responsible for the Formation of Pro-Prion Protein (PrP) in BxPC-3 Protein and Increases Cancer Cell Motility.
26667279 2016 Metabotropic glutamate receptor 5 couples cellular prion protein to intracellular signalling in Alzheimer's disease.
26528810 2016 The pathogenesis of soluble PrP fragments containing A? binding sites.
26368533 2015 Strain-Dependent Effect of Macroautophagy on Abnormally Folded Prion Protein Degradation in Infected Neuronal Cells.
26323476 2015 PrP charge structure encodes interdomain interactions.
26268531 2015 Iatrogenic CJD due to pituitary-derived growth hormone with genetically determined incubation times of up to 40 years.
26159734 2015 The prion protein inhibits monocytic cell migration by stimulating ?1 integrin adhesion and uropod formation.
More...