Property Summary

NCBI Gene PubMed Count 662
PubMed Score 5471.92
PubTator Score 5232.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
breast carcinoma 1614 1.03260173339082E-33
juvenile dermatomyositis 1189 1.80447097639127E-12
oligodendroglioma 2849 7.60461384169548E-10
Breast cancer 3099 2.99625056375602E-9
malignant mesothelioma 3163 1.96211722605773E-8
Amyotrophic Lateral Sclerosis 432 1.27953385666644E-7
lung cancer 4473 6.56511564505916E-7
Duchenne muscular dystrophy 602 2.07332403759482E-6
osteosarcoma 7933 2.08404342617073E-6
ulcerative colitis 2087 2.252234177447E-6
acute quadriplegic myopathy 1157 5.68527845126641E-6
ovarian cancer 8492 1.06744986615579E-5
sonic hedgehog group medulloblastoma 1482 2.15816711248329E-5
chronic lymphosyte leukemia 232 3.22440734195414E-5
Pick disease 1893 9.56529360751773E-5
colon cancer 1475 1.70449132044757E-4
cystic fibrosis 1670 3.42578070575824E-4
dermatomyositis 967 0.00126991139148993
primitive neuroectodermal tumor 3031 0.0013485267913921
pancreatic cancer 2300 0.00153545570488639
pancreatic carcinoma 567 0.00153545570488642
fascioscapulohumeral muscular dystrophy 100 0.00158986353056444
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00191582439277905
medulloblastoma, large-cell 6234 0.00205875326129802
Multiple myeloma 1328 0.00229962268652199
atypical teratoid / rhabdoid tumor 4369 0.00298864747151742
invasive ductal carcinoma 2950 0.00409595250407675
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00529847099132293
active Crohn's disease 918 0.0196203351490825
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0294594954464475
Down syndrome 548 0.033322809753563
glioblastoma 5572 0.0380517994658994
adult high grade glioma 2148 0.0383132221534035
Rheumatoid Arthritis 1171 0.0399681972236897
Disease Target Count Z-score Confidence
Creutzfeldt-Jakob disease 19 0.0 2.0
Disease Target Count Z-score Confidence
Prion disease 10 0.0 5.0
Wilson disease 16 0.0 5.0
Disease Target Count Z-score Confidence
Amyloidosis 68 3.703 1.9

Expression

Synonym

Accession F7VJQ1
Symbols CJD
GSS
PrP
ASCR
KURU
PRIP
PrPc
CD230
AltPrP
p27-30
PrP27-30
PrP33-35C

Gene

  Ortholog (11)

Gene RIF (608)

PMID Text
26946358 The results suggest a role of PrP(C) in proteostasis, dysfunctions of which may be involved in the pathogenesis of neurodegenerative diseases such as TSE and Alzheimer's Disease.
26778001 Overall, these results suggest that PrP(c) contribute the breast cancer invasion and migration via MMP-9.
26710111 PrP(C) is highly enriched on exosomes from SH-SY5Y cells and that exosomes bind amyloid beta via PrP(C).
26683373 these results show that multiple gene irregularity in BxPC-3 cells is responsible for the formation of pro-PrP, and binding of pro-PrP to filamin A contributes to enhanced tumor cell motility.
26667279 Genetic coupling between Prnp and glutamate receptor 5 is responsible for synapse loss in Alzheimer's disease transgenic mouse model.
26528810 PrP-Abeta oligomers binding might be the underlying mechanism of the prion diseases and Alzheimer's disease. [review]
26368533 The decrease in FK-derived PrPSc levels was mediated, at least in part, by the phosphatidylinositol 3-kinase/MEK signalling pathway.
26323476 Effects such as the stabilization of the native alpha-fold, dictating the efficiency of the alpha-cleavage, attenuating the fibrillation propensity and yielding the most benign amyloids suggest that the charge design ensures PrPC functions.
26268531 PRNP codon 129 polymorphism determines incubation time for iatrogenic Creutzfeldt-Jakob disease.
26159734 We propose that PrP modulates beta1 integrin adhesion and migration of monocytes through RhoA-induced actin remodeling mediated by cofilin, and through the regulation of ERM-mediated membrane-cytoskeleton linkage.
More...

AA Sequence

MEHWGQPIPGAGQPWRQPLPTSGRWWLGAASWWWLGAASWWWLGAAPWWWLGTASWWWLGSRRWHPQSVE      1 - 70
QAE                                                                        71 - 73
//

Text Mined References (661)

PMID Year Title
26946358 2016 The prion protein selectively binds to and modulates the content of purinergic receptor P2X4R.
26778001 2016 Cellular prion protein regulates invasion and migration of breast cancer cells through MMP-9 activity.
26710111 2016 Exosomal cellular prion protein drives fibrillization of amyloid beta and counteracts amyloid beta-mediated neurotoxicity.
26683373 2016 Glycosylphosphatidylinositol Anchor Modification Machinery Deficiency Is Responsible for the Formation of Pro-Prion Protein (PrP) in BxPC-3 Protein and Increases Cancer Cell Motility.
26667279 2016 Metabotropic glutamate receptor 5 couples cellular prion protein to intracellular signalling in Alzheimer's disease.
26528810 2016 The pathogenesis of soluble PrP fragments containing A? binding sites.
26368533 2015 Strain-Dependent Effect of Macroautophagy on Abnormally Folded Prion Protein Degradation in Infected Neuronal Cells.
26323476 2015 PrP charge structure encodes interdomain interactions.
26268531 2015 Iatrogenic CJD due to pituitary-derived growth hormone with genetically determined incubation times of up to 40 years.
26159734 2015 The prion protein inhibits monocytic cell migration by stimulating ?1 integrin adhesion and uropod formation.
More...