Property Summary

NCBI Gene PubMed Count 700
PubMed Score 5611.10
PubTator Score 5232.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count
Dementia 175
Abdominal symptom 1
Abnormal coordination 15
Abnormal visual pursuit 14
Absent reflex 92
Absent tendon reflex 92
Adult onset 82
Aggressive behavior 75
Aggressive reaction 75
Anxiety 136
Anxiety disease 113
Apathy 16
Aphasia 26
Apnea 45
Apraxias 27
Ataxia, Appendicular 25
Ataxia, Truncal 21
Atrophy of cerebellum 103
Attention deficit hyperactivity disorder 278
Autonomic nervous system disorders 19
Bradykinesia 34
Cell loss and gliosis in the basal ganglia 3
Cerebellar Ataxia 304
Cerebellar Dysmetria 56
Cerebellar degeneration 103
Childhood onset 38
Chorea 29
Choreatic disease 52
Confusion 21
Constipation 181
Deficit in phonologic short-term memory 1
Deglutition Disorders 132
Delusions 11
Depressive disorder 409
Diplopia 8
Dysarthria 192
Dysautonomia 20
Dyschezia 135
Encephalopathies 43
Extrapyramidal muscular rigidity 1
Fever 138
Forgetful 40
Gait Ataxia 51
Gait, Unsteady 29
Gliosis 56
Gliosis in the basal ganglia 3
Global brain atrophy 7
Hallucinations 34
Hallucinations, Sensory 33
Hemiparesis 34
Highly variable clinical phenotype 150
Highly variable phenotype and severity 150
Highly variable phenotype, even within families 150
Hyperhidrosis disorder 81
Hyperreflexia 209
Impaired smooth pursuit 14
Increased sweating 81
Infratentorial atrophy 103
Irritation - emotion 68
Jaw pain 2
Loss of facial expression 1
Low Vision 174
Memory Loss 40
Memory impairment 40
Monoparesis - leg 27
Mood Disorders 184
Mood swings 77
Muscle Rigidity 49
Muscle Spasticity 195
Myoclonus 74
Neurofibrillary degeneration (morphologic abnormality) 9
Neuronal loss 25
Parkinsonian Disorders 56
Personality change 23
Phenotypic variability 150
Physical aggression 76
Psychotic Disorders 151
Rapidly progressive 27
Rapidly progressive disorder 27
Reflex, Deep Tendon, Absent 92
Restlessness 14
Sleep disturbances 37
Sleeplessness 16
Specific learning disability 47
Supranuclear gaze palsy 6
Sweating 81
Tremor 113
Urinary Retention 6
Visual Impairment 174
Weakness of lower limb 27
Weight decreased 103
clinical depression 6
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Creutzfeldt-Jakob disease 21 0.0 3.0
Disease Target Count Z-score Confidence
Prion disease 16 0.0 5.0
Wilson disease 16 0.0 5.0
Disease Target Count Z-score Confidence
Amyloidosis 67 3.725 1.9

Expression

  Differential Expression (35)

Disease log2 FC p
Alzheimer's disease -1.200 1.9e-02
active Crohn's disease 1.438 2.0e-02
active ulcerative colitis 1.449 3.4e-02
acute quadriplegic myopathy 1.791 5.7e-06
adult high grade glioma -1.300 3.8e-02
Amyotrophic lateral sclerosis 1.715 1.3e-07
atypical teratoid / rhabdoid tumor -1.100 3.0e-03
autosomal dominant Emery-Dreifuss muscul... 1.538 1.9e-03
Breast cancer -2.200 3.0e-09
breast carcinoma -1.400 1.0e-33
chronic lymphosyte leukemia -1.400 3.2e-05
colon cancer -1.700 1.5e-06
cystic fibrosis 1.017 3.4e-04
dermatomyositis 1.700 1.3e-03
Down syndrome 1.100 3.3e-02
Duchenne muscular dystrophy 1.276 2.1e-06
fascioscapulohumeral muscular dystrophy 1.079 1.6e-03
glioblastoma -1.500 3.8e-02
intraductal papillary-mucinous adenoma (... -1.500 2.9e-02
intraductal papillary-mucinous carcinoma... -2.200 5.3e-03
invasive ductal carcinoma -1.190 2.3e-03
juvenile dermatomyositis 1.690 1.8e-12
lung cancer -2.600 6.6e-06
malignant mesothelioma -2.500 2.0e-08
medulloblastoma -1.200 4.1e-03
medulloblastoma, large-cell -1.800 2.1e-03
Multiple myeloma 1.740 2.3e-03
oligodendroglioma -1.100 7.6e-10
osteosarcoma 2.954 2.1e-06
ovarian cancer -2.300 1.1e-05
pancreatic cancer -1.400 1.5e-03
pancreatic carcinoma -1.400 1.5e-03
Pick disease -1.500 9.6e-05
primitive neuroectodermal tumor -1.200 1.3e-04
Rheumatoid arthritis -1.200 4.0e-02

Synonym

Accession F7VJQ1
Symbols CJD
GSS
PrP
ASCR
KURU
PRIP
PrPc
CD230
AltPrP
p27-30
PrP27-30
PrP33-35C

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (639)

AA Sequence

MEHWGQPIPGAGQPWRQPLPTSGRWWLGAASWWWLGAASWWWLGAAPWWWLGTASWWWLGSRRWHPQSVE      1 - 70
QAE                                                                        71 - 73
//

Text Mined References (699)

PMID Year Title