Property Summary

Ligand Count 266
NCBI Gene PubMed Count 425
PubMed Score 3424.86
PubTator Score 338.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Vascular disease 319 0.0 3.0
Disease Target Count
Hemorrhagic disease 3

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 7.3e-05
atypical teratoid / rhabdoid tumor -1.300 2.4e-06
glioblastoma -1.400 1.3e-06
group 4 medulloblastoma -1.100 1.8e-04
malignant mesothelioma 1.900 1.9e-04
medulloblastoma, large-cell -1.200 1.0e-05
pancreatic ductal adenocarcinoma liver m... -1.873 4.0e-02

Protein-protein Interaction (3)

PDB (108)

Gene RIF (390)

AA Sequence

MVSQALRLLCLLLGLQGCLAAGGVAKASGGETRDMPWKPGPHRVFVTQEEAHGVLHRRRRANAFLEELRP      1 - 70
GSLERECKEEQCSFEEAREIFKDAERTKLFWISYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRN     71 - 140
CETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQ    141 - 210
GRIVGGKVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVSAAHCFDKIKNWRNLIAVLGEHDLSEHDGDE    211 - 280
QSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDR    281 - 350
GATALELMVLNVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDSCKGDSGGPHATHYRGTWYLTG    351 - 420
IVSWGQGCATVGHFGVYTRVSQYIEWLQKLMRSEPRPGVLLRAPFP                            421 - 466
//

Text Mined References (435)

PMID Year Title