Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 0.000

AA Sequence

MNHFRKMEVINLTTLPMIPVDEHLAVSLVARNTMVKTVRKELENNPPSCLIGSMHQVNQKIADINLRTEP      1 - 70
SANSLAIERFELEKKALREKTRSSPEDKVKRQRKSQYSCKGSELRHARSSVIKRKTADKNLLAELYQYSN     71 - 140
FNSSKPNKLPNGVDFCDMVGNVVRAERDCLSGKHFCSGRELEKFLSSSSPRAIWLDSFWWIFHERYQPNK    141 - 210
ELQNNLFDRIAQHYALLLFRVPKSHSEEALLKRLPSLLSKAVYTSFCCCFPQSWFDTHEFKSDICNTMSL    211 - 280
WISGTYPSPQSYDSWDYSELDPERFRREELMLYRRRLTKGREFSLFAGKRAFSQKPAQSRKFYHPQSSSA    281 - 350
NSPSEKTSSAKQNSEKSLRMQNTAKEHHCQTLVLKKPTQEVKRISEARECENMFPKKSCAACKSPELTSN    351 - 420
LFNIYGKSPLIVYFLQNYASLQQHGKNVLIVRREKTTSTPDCTPTYTDVISETLCSMKKRKDNLNQLYQH    421 - 490
HWTEWNYFDKHLKELQDNFSREMKNIDPKAADTKKANHMFIPPSAVNEESPDKKTKEGKGGEGKRRETEV    491 - 560
EHFFPLTSKP                                                                561 - 570
//

Text Mined References (5)

PMID Year Title
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10591208 1999 The DNA sequence of human chromosome 22.