Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 5.69324690822023E-12
atypical teratoid / rhabdoid tumor 4369 3.485688127951E-10
glioblastoma 5572 1.30701888590711E-6
medulloblastoma 1524 3.05373989823352E-6
primitive neuroectodermal tumor 3031 6.98708354313781E-5
pilocytic astrocytoma 3086 1.4157735397469E-4
pediatric high grade glioma 2712 6.89407168802562E-4
ependymoma 2514 0.00113257618855378
astrocytic glioma 2241 0.0011394454707284
invasive ductal carcinoma 2950 0.0034710017470644
ductal carcinoma in situ 1745 0.00519653659767881
Pick disease 1893 0.00581948901355795
osteosarcoma 7933 0.00779774251911965
ovarian cancer 8492 0.00796318013453048
oligodendroglioma 2849 0.00910078209025434
Breast cancer 3099 0.0102570828144352

AA Sequence

MWGPGVTAEGLSVAPAPPPLLPLLLLLALALVAPSRGGGGCAELACGERERCCDATNATAVRCCKLPLHA      1 - 70
FLDNVGWFVRKLSGLLILLVLFAIGYFLQRIICPSPRRYPRGQARPGQRPGPPGGAGPLGGAGPPDDDDD     71 - 140
SPALLRDEAAAGSQDSLLDSGGGGRGRGGGGRSDPSCASEHEMRVVSPVFLQLPSYEEVKYLPTYEESMR    141 - 210
LQQLSPGEVVLPVSVLGRPRGGVAAEPDGGEGRYPLI                                     211 - 247
//

Text Mined References (4)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.