Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.800 3.2e-02
astrocytic glioma -3.000 1.1e-03
Astrocytoma, Pilocytic -2.200 1.4e-04
atypical teratoid / rhabdoid tumor -2.900 3.5e-10
Breast cancer 1.300 1.0e-02
ductal carcinoma in situ 1.400 5.2e-03
ependymoma -3.200 1.1e-03
glioblastoma -1.900 1.8e-05
group 3 medulloblastoma -2.200 4.9e-02
invasive ductal carcinoma 1.053 3.5e-03
oligodendroglioma -2.600 9.1e-03
osteosarcoma -1.389 7.8e-03
ovarian cancer 1.900 8.0e-03
Pick disease -1.700 5.8e-03
primitive neuroectodermal tumor -2.600 7.0e-05
psoriasis -1.100 5.7e-12

AA Sequence

MWGPGVTAEGLSVAPAPPPLLPLLLLLALALVAPSRGGGGCAELACGERERCCDATNATAVRCCKLPLHA      1 - 70
FLDNVGWFVRKLSGLLILLVLFAIGYFLQRIICPSPRRYPRGQARPGQRPGPPGGAGPLGGAGPPDDDDD     71 - 140
SPALLRDEAAAGSQDSLLDSGGGGRGRGGGGRSDPSCASEHEMRVVSPVFLQLPSYEEVKYLPTYEESMR    141 - 210
LQQLSPGEVVLPVSVLGRPRGGVAAEPDGGEGRYPLI                                     211 - 247
//

Text Mined References (4)

PMID Year Title