Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession F5GYI3 UBAP-1L
Symbols UBAP-1L

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MNALDGVPFKLPKGFVIGTEPLPGPELSVPACGEVLLGSMHDFSLERTALFWVEAAGQGPSPYQCGDPGT      1 - 70
ASAPPAWLLLVSPEHGLAPAPTTIRDPEAGHQERPEEEGEDEAEASSGSEEEPAPSSLQPGSPASPGPGR     71 - 140
RLCSLDVLRGVRLELAGARRRLSEGKLVSRPRALLHGLRGHRALSLCPSPAQSPRSASPPGPAPQHPAAP    141 - 210
ASPPRPSTAGAIPPLRSHKPTVASLSPYTCLPPLGGAPQPLNPHKSHPDTAADLLSALSQEEQDLIGPVV    211 - 280
ALGYPLRRAIIALQKTGRQSLSQFLSYLSACDRLLRQGYEEGLVDEAMEMFQFSESQAGEFLRLWEQFSD    281 - 350
MGFQQDRIKEVLLVHGNRREQALEELVACAQ                                           351 - 381
//

Text Mined References (5)

PMID Year Title